NKX2.2 Antibody

Images

 
Western Blot: NKX2.2 Antibody [NBP1-82554] - Analysis in human cell line U-138 MG.
Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554] - Staining of human pancreas shows strong nuclear positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKX2.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NKX2-2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
NKX2.2 Protein (NBP1-82554PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-82554 in the following applications:

Publications
Read Publications using NBP1-82554.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24413736)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKX2.2 Antibody

  • Homeobox protein NK-2 homolog B
  • NK-2 (Drosophila) homolog B
  • NK2 homeobox 2
  • NK2 transcription factor related, locus 2 (Drosophila)
  • NK2 transcription factor related, locus 2
  • NK2 transcription factor-like protein B
  • NKX2.2
  • NKX2.2homeobox protein Nkx-2.2
  • NKX2B
  • NKX2BNK-2 homolog B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
AF2746
Species: Hu, Mu
Applications: WB, ICC
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
AF2614
Species: Hu
Applications: WB, ICC
AF6014
Species: Hu, Mu, Rt
Applications: WB
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF2567
Species: Mu
Applications: WB, IHC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2417
Species: Hu, Mu
Applications: WB, IHC
AF2864
Species: Hu
Applications: WB, ICC

Publications for NKX2.2 Antibody (NBP1-82554)(3)

Reviews for NKX2.2 Antibody (NBP1-82554) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Feline.
We have 2 reviews tested in 2 application: ICC, IHC-Fr.

Reviews using NBP1-82554:
Filter by Applications
ICC
(1)
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
Feline
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry NKX2.2 NBP1-82554
Enlarge
reviewed by:
Anonymous
ICC Feline 06/23/2017
View

Summary

ApplicationImmunocytochemistry
Sample TestedOptic nerve
SpeciesFeline
LotB81867

Comments

Comments4%PFA fixed tissue
Immunohistochemistry-Frozen NKX2.2 NBP1-82554
Enlarge
reviewed by:
Jason Spaeth
IHC-Fr Mouse 11/09/2016
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedMouse pancreas in OCT
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKX2.2 Antibody (NBP1-82554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKX2.2 Products

Bioinformatics Tool for NKX2.2 Antibody (NBP1-82554)

Discover related pathways, diseases and genes to NKX2.2 Antibody (NBP1-82554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX2.2 Antibody (NBP1-82554)

Discover more about diseases related to NKX2.2 Antibody (NBP1-82554).
 

Pathways for NKX2.2 Antibody (NBP1-82554)

View related products by pathway.

PTMs for NKX2.2 Antibody (NBP1-82554)

Learn more about PTMs related to NKX2.2 Antibody (NBP1-82554).

Blogs on NKX2.2

There are no specific blogs for NKX2.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
1
4
0
3
1
2
0
1
0

Anonymous
06/23/2017
Application: ICC
Species: Feline

Jason Spaeth
11/09/2016
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol NKX2-2
Entrez
Uniprot