PABPC4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Analysis in human skeletal muscle and liver tissues using NBP2-13722 antibody. Corresponding PABPC4 RNA-seq data are presented for the same tissues.

Western Blot: PABPC4 Antibody [NBP2-13722] - Analysis using Anti-PABPC4 antibody NBP2-13722 (A) shows similar pattern to independent antibody NBP2-58575 (B).

Immunocytochemistry/Immunofluorescence: PABPC4 Antibody [NBP2-13722] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PABPC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PABPC4 Antibody - BSA Free (NBP2-13722) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAP
• Predicted Species: Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PABPC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PABPC4 Protein (NBP2-13722PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PABPC4 Antibody - BSA Free

• APP1FLJ43938
• APP-1PABP-4
• Inducible poly(A)-binding protein
• IPABP
• iPABPpoly(A)-binding protein, cytoplasmic 4 (inducible form)
• PABP4Activated-platelet protein 1
• poly(A) binding protein, cytoplasmic 4 (inducible form)
• Poly(A)-binding protein 4
• polyadenylate-binding protein 4

Background

Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PABPC4