KRIT1 Antibody

Images

 
Immunohistochemistry-Paraffin: KRIT1 Antibody [NBP2-47405] - Staining of human liver shows no cytoplasmic positivity in hepatocytes.
Immunohistochemistry: KRIT1 Antibody [NBP2-47405] - Staining of human small intestine shows distinct positivity in a subset of vessels.
Immunohistochemistry-Paraffin: KRIT1 Antibody [NBP2-47405] - Staining of human duodenum shows strong cytoplasmic positivity in blood vessels.
Immunohistochemistry-Paraffin: KRIT1 Antibody [NBP2-47405] - Staining of human heart muscle shows strong cytoplasmic positivity in blood vessels.
Immunohistochemistry-Paraffin: KRIT1 Antibody [NBP2-47405] - Staining of human spleen shows strong cytoplasmic positivity in blood vessels.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRIT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIV
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRIT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRIT1 Protein (NBP2-47405PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRIT1 Antibody

  • CAMcerebral cavernous malformations 1
  • CCM1ankyrin repeat-containing protein Krit1
  • Cerebral cavernous malformations 1 protein
  • Krev interaction trapped 1
  • krev interaction trapped protein 1
  • KRIT1, ankyrin repeat containing

Background

The KRIT1 gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, andmultiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrincytoplasmic domain-associated protei

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
233-FB/CF
Species: Hu
Applications: BA
NBP2-93073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
210-TA
Species: Hu
Applications: BA
796-IC
Species: Mu
Applications: BA
NBP2-01134
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NBP2-83556
Species: Hu
Applications: WB
NBP2-16382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
7268-CT
Species: Hu
Applications: BA

Publications for KRIT1 Antibody (NBP2-47405) (0)

There are no publications for KRIT1 Antibody (NBP2-47405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRIT1 Antibody (NBP2-47405) (0)

There are no reviews for KRIT1 Antibody (NBP2-47405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRIT1 Antibody (NBP2-47405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRIT1 Products

Array NBP2-47405

Bioinformatics Tool for KRIT1 Antibody (NBP2-47405)

Discover related pathways, diseases and genes to KRIT1 Antibody (NBP2-47405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KRIT1 Antibody (NBP2-47405)

Discover more about diseases related to KRIT1 Antibody (NBP2-47405).
 

Pathways for KRIT1 Antibody (NBP2-47405)

View related products by pathway.

PTMs for KRIT1 Antibody (NBP2-47405)

Learn more about PTMs related to KRIT1 Antibody (NBP2-47405).
 

Research Areas for KRIT1 Antibody (NBP2-47405)

Find related products by research area.

Blogs on KRIT1

There are no specific blogs for KRIT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRIT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRIT1