KRIT1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIV |
Predicted Species |
Mouse (95%), Rat (97%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KRIT1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for KRIT1 Antibody
Background
The KRIT1 gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, andmultiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrincytoplasmic domain-associated protei
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Publications for KRIT1 Antibody (NBP2-47405) (0)
There are no publications for KRIT1 Antibody (NBP2-47405).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KRIT1 Antibody (NBP2-47405) (0)
There are no reviews for KRIT1 Antibody (NBP2-47405).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for KRIT1 Antibody (NBP2-47405) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KRIT1 Products
Bioinformatics Tool for KRIT1 Antibody (NBP2-47405)
Discover related pathways, diseases and genes to KRIT1 Antibody (NBP2-47405). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KRIT1 Antibody (NBP2-47405)
Discover more about diseases related to KRIT1 Antibody (NBP2-47405).
| | Pathways for KRIT1 Antibody (NBP2-47405)
View related products by pathway.
|
PTMs for KRIT1 Antibody (NBP2-47405)
Learn more about PTMs related to KRIT1 Antibody (NBP2-47405).
| | Research Areas for KRIT1 Antibody (NBP2-47405)
Find related products by research area.
|
Blogs on KRIT1