P4HA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining in human placenta and pancreas tissues using NBP1-84398 antibody. Corresponding P4HA1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: P4HA1 Antibody [NBP1-84398] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell lines PC-3 and HEK293 using Anti-P4HA1 antibody. Corresponding P4HA1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P4HA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit P4HA1 Antibody - BSA Free (NBP1-84398) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-P4HA1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P4HA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
• Control Peptide:

  P4HA1 Protein (NBP1-84398PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for P4HA1 Antibody - BSA Free

• 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
• 2-oxoglutarate-4-dioxygenase subunit alpha-1
• 4-PH Alpha-1
• alpha polypeptide I
• EC 1.14.11.2
• P4HA
• P4HA1
• Procollagen-proline
• prolyl 4-hydroxylase, alpha polypeptide I

Background

P4HA1 encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for P4HA1 Antibody (NBP1-84398)(10)

Publications using NBP1-84398

• Duatti A Lactate-induced COL1A1/DDR1 axis promotes prostate cancer aggressiveness and enhances metastatic colonization Thesis 2023-01-01 (WB)
• Tian P, Koudis N, Morais M et al. Collagen IV Assembly is Influenced by Fluid Flow in Kidney Cell-Derived Matrices SSRN 2023-11-03 (WB, Human)
  
  Details:
  Dilution 0.12?g/ml
• Tian P, Koudis NM, Morais MRPT, Pickard A et Al. Collagen IV assembly is influenced by fluid flow in kidney cell-derived matrices Cells Dev 2024-04-26 [PMID: 38670459]
• Bhute V, Harte J, Houghton J, Maxwell P Mannose binding lectin is hydroxylated by collagen prolyl-4-hydroxylase and inhibited by some PHD inhibitors Kidney360 2022-04-04 [PMID: 35368589] (Western Blot, Immunohistochemistry-Paraffin, Human)
• Bhute V, Harte J, Houghton J, Maxwell P Mannose binding lectin is hydroxylated by collagen prolyl-4-hydroxylase and inhibited by some PHD inhibitors Kidney360 Apr 3 2020 (WB, Human)
• Liu Y, Gu Y, Ng S et al. Circulating levels of hydroxylated bradykinin function as an indicator of tissue HIF-1alpha expression Science Bulletin 2020-01-01 (IHC-P, WB, Human)
• Liu Y, Gu Y, Ng S Et Al. Circulating levels of hydroxylated bradykinin function as an indicator of tissue HIF-1 alpha expression Science Bulletin 2020-01-01 [PMID: 36738075] (WB, EA, Human)
• Kaluz S, Zhang Q, Kuranaga Y Et Al. Targeting HIF-activated collagen prolyl 4-hydroxylase expression disrupts collagen deposition and blocks primary and metastatic uveal melanoma growth Oncogene 2021-07-03 [PMID: 34218269] (WB)
• Morimoto C, Takedachi M, Kawasaki K et al. Hypoxia stimulates collagen hydroxylation in gingival fibroblasts and periodontal ligament cells Journal of periodontology 2021-03-04 [PMID: 33660864]
• Eriksson J, Le Joncour V, Jahkola T et al. Prolyl 4-hydroxylase subunit alpha 1 (P4HA1) is a biomarker of poor prognosis in primary melanomas, and its depletion inhibits melanoma cell invasion and disrupts tumor blood vessel walls Mol Oncol 2020-04-01 [PMID: 32053263] (WB, IHC-P, Human)

Reviews for P4HA1 Antibody (NBP1-84398) (2)

Average Rating: 4

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Pinyuan Tian WB Human 10/24/2022

Summary

• Application: Western Blot
• Sample Tested: Immortalized human podocytes
• Species: Human
• Lot: 000025785

reviewed by: Verified Customer WB Human 04/18/2017

Summary

• Application: Western Blot
• Sample Tested: U87MG whole cell lysate
• Species: Human
• Lot: A95450

Comments

• Comments: Antibody used at 1:1000 dilution

Bioinformatics

• Gene Symbol: P4HA1