Novus Biologicals products are now on bio-techne.com

P4HA1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining in human placenta and pancreas tissues using NBP1-84398 antibody. Corresponding P4HA1 RNA-seq data are presented for ...read more
Orthogonal Strategies: Western Blot: P4HA1 Antibody [NBP1-84398] - Analysis in human cell lines PC-3 and HEK293 using Anti-P4HA1 antibody. Corresponding P4HA1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: P4HA1 Antibody [NBP1-84398] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.
Western Blot: P4HA1 Antibody [NBP1-84398] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.
Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

P4HA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P4HA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Control Peptide
P4HA1 Protein (NBP1-84398PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-84398 in the following applications:

Publications
Read Publications using
NBP1-84398 in the following applications:

  • EA
    1 publication
  • 2 publications
  • WB
    7 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P4HA1 Antibody

  • 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
  • 2-oxoglutarate-4-dioxygenase subunit alpha-1
  • 4-PH Alpha-1
  • alpha polypeptide I
  • EC 1.14.11.2
  • P4HA
  • P4HA1
  • Procollagen-proline
  • prolyl 4-hydroxylase, alpha polypeptide I

Background

P4HA1 encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33878
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
DVE00
Species: Hu
Applications: ELISA
7754-BH/CF
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB8761
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-84396
Species: Hu
Applications: IHC, IHC-P
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NB100-137
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-84398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for P4HA1 Antibody (NBP1-84398)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: EA, IHC-P, WB.


Filter By Application
EA
(1)
IHC-P
(2)
WB
(7)
All Applications
Filter By Species
Human
(5)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-84398 Applications Species
Duatti A Lactate-induced COL1A1/DDR1 axis promotes prostate cancer aggressiveness and enhances metastatic colonization Thesis 2023-01-01 (WB) WB
Tian P, Koudis N, Morais M et al. Collagen IV Assembly is Influenced by Fluid Flow in Kidney Cell-Derived Matrices SSRN 2023-11-03 (WB, Human)

Details:
Dilution 0.12?g/ml
WB Human
Bhute V, Harte J, Houghton J, Maxwell P Mannose binding lectin is hydroxylated by collagen prolyl-4-hydroxylase and inhibited by some PHD inhibitors Kidney360 Apr 3 2020 (WB, Human) WB Human
Liu Y, Gu Y, Ng S et al. Circulating levels of hydroxylated bradykinin function as an indicator of tissue HIF-1alpha expression Science Bulletin 2020-01-01 (IHC-P, WB, Human) IHC-P, WB Human
Liu Y, Gu Y, Ng S Et Al. Circulating levels of hydroxylated bradykinin function as an indicator of tissue HIF-1 alpha expression Science Bulletin 2020-01-01 [PMID: 36738075] (WB, EA, Human) WB, EA Human
Kaluz S, Zhang Q, Kuranaga Y Et Al. Targeting HIF-activated collagen prolyl 4-hydroxylase expression disrupts collagen deposition and blocks primary and metastatic uveal melanoma growth Oncogene 2021-07-03 [PMID: 34218269] (WB) WB
Morimoto C, Takedachi M, Kawasaki K et al. Hypoxia stimulates collagen hydroxylation in gingival fibroblasts and periodontal ligament cells Journal of periodontology 2021-03-04 [PMID: 33660864]
Eriksson J, Le Joncour V, Jahkola T et al. Prolyl 4-hydroxylase subunit alpha 1 (P4HA1) is a biomarker of poor prognosis in primary melanomas, and its depletion inhibits melanoma cell invasion and disrupts tumor blood vessel walls Mol Oncol 2020-04-01 [PMID: 32053263] (WB, IHC-P, Human) WB, IHC-P Human

Reviews for P4HA1 Antibody (NBP1-84398) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-84398:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot P4HA1 NBP1-84398
Enlarge
4
reviewed by:
Pinyuan Tian
WB Human 10/24/2022
View

Summary

ApplicationWestern Blot
Sample TestedImmortalized human podocytes
SpeciesHuman
Lot000025785
Western Blot P4HA1 NBP1-84398
Enlarge
4
reviewed by:
Verified Customer
WB Human 04/18/2017
View

Summary

ApplicationWestern Blot
Sample TestedU87MG whole cell lysate
SpeciesHuman
LotA95450

Comments

CommentsAntibody used at 1:1000 dilution

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for P4HA1 Antibody (NBP1-84398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Pinyuan Tian
10/24/2022
Application: WB
Species: Human

Verified Customer
04/18/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol P4HA1