P4HA1 Antibody

Images

 
Western Blot: P4HA1 Antibody [NBP1-84398] - Analysis in human cell lines PC-3 and HEK293 using Anti-P4HA1 antibody. Corresponding P4HA1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/ Immunofluorescence: P4HA1 Antibody [NBP1-84398] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles.
Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.
Western Blot: P4HA1 Antibody [NBP1-84398] - Analysis in human cell line U-87 MG.
Western Blot: P4HA1 Antibody [NBP1-84398] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P4HA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P4HA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
P4HA1 Protein (NBP1-84398PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-84398 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P4HA1 Antibody

  • 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
  • 2-oxoglutarate-4-dioxygenase subunit alpha-1
  • 4-PH alpha-1
  • alpha polypeptide I
  • EC 1.14.11.2
  • Procollagen-proline
  • prolyl 4-hydroxylase, alpha polypeptide I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40494
Species: Hu, Rt
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF776
Species: Mu
Applications: WB, IHC
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84396
Species: Hu
Applications: IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
H00010609-M01
Species: Hu
Applications: WB, ELISA
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for P4HA1 Antibody (NBP1-84398) (0)

There are no publications for P4HA1 Antibody (NBP1-84398).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for P4HA1 Antibody (NBP1-84398) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-84398:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot P4HA1 NBP1-84398
Enlarge
reviewed by:
Anonymous
WB Human 04/18/2017
View

Summary

ApplicationWestern Blot
Sample TestedU87MG whole cell lysate
SpeciesHuman
LotA95450

Comments

CommentsAntibody used at 1:1000 dilution

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for P4HA1 Antibody (NBP1-84398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P4HA1 Products

Bioinformatics Tool for P4HA1 Antibody (NBP1-84398)

Discover related pathways, diseases and genes to P4HA1 Antibody (NBP1-84398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P4HA1 Antibody (NBP1-84398)

Discover more about diseases related to P4HA1 Antibody (NBP1-84398).
 

Pathways for P4HA1 Antibody (NBP1-84398)

View related products by pathway.

PTMs for P4HA1 Antibody (NBP1-84398)

Learn more about PTMs related to P4HA1 Antibody (NBP1-84398).

Blogs on P4HA1

There are no specific blogs for P4HA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
04/18/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol P4HA1