P4HA3 Antibody

Images

 
Immunohistochemistry-Paraffin: P4HA3 Antibody [NBP1-84396] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P4HA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P4HA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
P4HA3 Recombinant Protein Antigen (NBP1-84396PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-84396 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P4HA3 Antibody

  • 2-oxoglutarate-4-dioxygenase subunit alpha-3
  • 4-PH alpha-3
  • alpha polypeptide III
  • collagen prolyl 4-hydroxylase alpha(III)
  • C-P4H alpha III
  • C-P4Halpha(III)
  • EC 1.14.11.2
  • Procollagen-proline
  • procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
  • prolyl 4-hydroxylase subunit alpha-3
  • prolyl 4-hydroxylase, alpha polypeptide III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6574
Species: Mu
Applications: WB
NB100-57852
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
H00010609-M01
Species: Hu
Applications: WB, ELISA
NB110-40494
Species: Hu, Rt
Applications: WB, IP
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-94105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-57365
Species: Hu
Applications: WB
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-94041
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064175-B01P
Species: Hu
Applications: WB

Publications for P4HA3 Antibody (NBP1-84396) (0)

There are no publications for P4HA3 Antibody (NBP1-84396).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for P4HA3 Antibody (NBP1-84396) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-84396:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot P4HA3 NBP1-84396
Enlarge
reviewed by:
Anonymous
WB Human 03/29/2017
View

Summary

ApplicationWestern Blot
Sample TestedHuman breast cancer cell lines
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for P4HA3 Antibody (NBP1-84396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P4HA3 Products

Bioinformatics Tool for P4HA3 Antibody (NBP1-84396)

Discover related pathways, diseases and genes to P4HA3 Antibody (NBP1-84396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P4HA3 Antibody (NBP1-84396)

Discover more about diseases related to P4HA3 Antibody (NBP1-84396).
 

Pathways for P4HA3 Antibody (NBP1-84396)

View related products by pathway.

PTMs for P4HA3 Antibody (NBP1-84396)

Learn more about PTMs related to P4HA3 Antibody (NBP1-84396).

Blogs on P4HA3

There are no specific blogs for P4HA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
03/29/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol P4HA3