Opticin Antibody

Images

 
Western Blot: Opticin Antibody [NBP2-55115] - Analysis in control (vector only transfected HEK293T lysate) and OPTC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human kidney.
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human eye shows moderate positivity in vitreous of the eye.
Independent Antibodies: Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum, eye, kidney and lymph node using Anti-OPTC antibody NBP2-55115 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Opticin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPTC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Opticin Recombinant Protein Antigen (NBP2-55115PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Opticin Antibody

  • oculoglycan
  • Oculogylcan
  • OPT
  • OPTC
  • Opticin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3110
Species: Hu
Applications: ICC, WB
DVE00
Species: Hu
Applications: ELISA
664-LI/CF
Species: Hu
Applications: BA
AF5945
Species: Hu, Mu, Rt
Applications: WB
AF2949
Species: Mu
Applications: WB
NBP1-56853
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF6447
Species: Hu
Applications: ICC, Neut, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2745
Species: Mu
Applications: IHC, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
NBP2-52932
Species: Hu
Applications: IHC, IHC-P, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-52575
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-69668
Species: Hu
Applications: WB
NBP2-84247
Species: Hu
Applications: WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for Opticin Antibody (NBP2-55115) (0)

There are no publications for Opticin Antibody (NBP2-55115).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Opticin Antibody (NBP2-55115) (0)

There are no reviews for Opticin Antibody (NBP2-55115). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Opticin Antibody (NBP2-55115) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Opticin Products

Bioinformatics Tool for Opticin Antibody (NBP2-55115)

Discover related pathways, diseases and genes to Opticin Antibody (NBP2-55115). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Opticin Antibody (NBP2-55115)

Discover more about diseases related to Opticin Antibody (NBP2-55115).
 

Pathways for Opticin Antibody (NBP2-55115)

View related products by pathway.

PTMs for Opticin Antibody (NBP2-55115)

Learn more about PTMs related to Opticin Antibody (NBP2-55115).

Blogs on Opticin

There are no specific blogs for Opticin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Opticin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPTC