DSPG3/EPYC Antibody - BSA Free

Immunohistochemistry-Paraffin: DSPG3/EPYC Antibody [NBP1-70338] - Staining of human placenta shows cytoplasmic positivity in decidua cells.

Analysis in human placenta tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DSPG3/EPYC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNV
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPYC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DSPG3/EPYC Recombinant Protein Antigen (NBP1-70338PEP)

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DSPG3/EPYC Antibody - BSA Free

• Dermatan sulfate proteoglycan 3dermatan sulphate proteoglycan 3
• DSPG3
• DSPG3proteoglycan-lb
• Epiphycan
• EPYC
• PGLB
• PG-Lb
• Proteoglycan-Lb
• SLRR3B
• SLRR3Bepiphycan proteoglycan
• Small chondroitin/dermatan sulfate proteoglycan

Background

Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DSPG3/EPYC Antibody (NBP1-70338)(3)

Publications using NBP1-70338

• Yuan P, Zhang M, Tong L et al. PLD3 affects axonal spheroids and network defects in Alzheimer's disease Nature 2022-11-30 [PMID: 36450991] (Mouse)
• Axelrod ML, Meijers WC, Screever EM et al. T cells specific for myosin drive immunotherapy-related myocarditis Nature 2022-11-01 [PMID: 36385524] (IHC-P, Mouse)
• Axelrod ML, Meijers WC, Screever EM et al. T cells specific for alpha -myosin drive immunotherapy-related myocarditis Nature 2022-11-01 [PMID: 36385524] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: EPYC
• Entrez:
  • 1833(Human)
• Uniprot:
  • Q99645()