DSPG3/EPYC Antibody

Images

 
Immunohistochemistry: DSPG3/EPYC Antibody [NBP1-70338] - Staining of human placenta shows cytoplasmic positivity in decidua cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSPG3/EPYC Antibody Summary

Immunogen
Epiphycan recombinant protein specific to aa 198-281 of human EPYC (Q99645). LRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNV
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPYC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
DSPG3/EPYC Recombinant Protein Antigen (NBP1-70338PEP)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSPG3/EPYC Antibody

  • Dermatan sulfate proteoglycan 3dermatan sulphate proteoglycan 3
  • DSPG3
  • DSPG3proteoglycan-lb
  • Epiphycan
  • EPYC
  • PGLB
  • PG-Lb
  • Proteoglycan-Lb
  • SLRR3B
  • SLRR3Bepiphycan proteoglycan
  • Small chondroitin/dermatan sulfate proteoglycan

Background

Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF2846
Species: Hu
Applications: WB, IHC
NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84425
Species: Hu
Applications: WB, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
AF5945
Species: Hu, Mu, Rt
Applications: WB
AF3547
Species: Mu
Applications: WB
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, IHC, IHC-P, PEP-ELISA
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6447
Species: Hu
Applications: WB, ICC, Neut
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
FAB8628P
Species: Mu
Applications: Flow
NBP1-85551
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-70338
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for DSPG3/EPYC Antibody (NBP1-70338) (0)

There are no publications for DSPG3/EPYC Antibody (NBP1-70338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSPG3/EPYC Antibody (NBP1-70338) (0)

There are no reviews for DSPG3/EPYC Antibody (NBP1-70338). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DSPG3/EPYC Antibody (NBP1-70338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DSPG3/EPYC Antibody Products

Related Products by Gene

Bioinformatics Tool for DSPG3/EPYC Antibody (NBP1-70338)

Discover related pathways, diseases and genes to DSPG3/EPYC Antibody (NBP1-70338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSPG3/EPYC Antibody (NBP1-70338)

Discover more about diseases related to DSPG3/EPYC Antibody (NBP1-70338).
 

Pathways for DSPG3/EPYC Antibody (NBP1-70338)

View related products by pathway.

PTMs for DSPG3/EPYC Antibody (NBP1-70338)

Learn more about PTMs related to DSPG3/EPYC Antibody (NBP1-70338).

Blogs on DSPG3/EPYC

There are no specific blogs for DSPG3/EPYC, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSPG3/EPYC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPYC
Entrez
Uniprot

Customers Who Bought This Also Bought