Apolipoprotein A-IV/ApoA4 Antibody (CL0468)

Images

 
Western Blot: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Lane 1: Marker [kDa], Lane 2: Human plasma
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Immunohistochemical analysis of paraffin-embedded human colon tissue using Apolipoprotein A-IV/ApoA4 antibody. Image from ...read more
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human fallopian tube shows strong immunoreactivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human kidney shows strong positivity in renal tubules.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human liver shows strong positivity in some hepatocytes.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human pancreas shows absence of immunoreactivity (negative control).
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human rectum shows moderate positivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody (CL0468) [NBP2-52932] - Staining of human duodenum shows strong cytoplasmic immunoreactivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL0468
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein A-IV/ApoA4 Antibody (CL0468) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Epitope
GHLSFLEKDL
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
APOA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen (NBP2-52932PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-52932 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Apolipoprotein A-IV/ApoA4 Antibody (CL0468)

  • apo-AIV
  • apoA-IV
  • Apolipoprotein A4
  • Apolipoprotein AIV
  • Apolipoprotein A-IV
  • MGC142154
  • MGC142156

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-92734
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75410
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
AF4497
Species: Hu
Applications: Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NB400-139
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
DHAPG0
Species: Hu
Applications: ELISA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-05950
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP3-06290
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932) (0)

There are no publications for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-52932:
Filter by Applications
Immunohistochemistry-Paraffin
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Apolipoprotein A-IV/ApoA4 NBP2-52932
Enlarge
5
reviewed by:
Ashleigh Dean
Immunohistochemistry-Paraffin Human 01/05/2022
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedColon tissue
SpeciesHuman
LotCL0468

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932). (Showing 1 - 1 of 1 FAQ).

  1. I would like to buy antibodies APOA4 (apolipoprotein AIV) for the cows (to western blot). I know that You don't have the antibodies for this species. Could You propose the best atibodies which I could test (use) in my experiment?
    • All eight of our APOA4 antibodies were raised against the human protein, and all of them have currently only been tested against human samples. I ran an alignment for you and found that there is a 77% sequence homology between human and bovine APOA4, so it is possible that the antibodies raised against human APOA4 may recognise the bovine protein. Should you wish to try any of our antibodies with your samples, you may be interested in our Innovator's Reward Program, which allows you to try our primary antibodies in an untested species or application without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein A-IV/ApoA4 Products

Bioinformatics Tool for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932)

Discover related pathways, diseases and genes to Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932)

Discover more about diseases related to Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932).
 

Pathways for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932)

View related products by pathway.

PTMs for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932)

Learn more about PTMs related to Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932).
 

Research Areas for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52932)

Find related products by research area.

Blogs on Apolipoprotein A-IV/ApoA4

There are no specific blogs for Apolipoprotein A-IV/ApoA4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Ashleigh Dean
01/05/2022
Application: Immunohistochemistry-Paraffin
Species: Human

Bioinformatics

Gene Symbol APOA4