Nocturnin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nocturnin Antibody [NBP2-37939] - Staining of human cell line A-431 shows localization to nuclear bodies & cytosol.
Immunohistochemistry: Nocturnin Antibody [NBP2-37939] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nocturnin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQW
Specificity
Specificity of human Nocturnin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCRN4L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nocturnin Antibody

  • CCR4 carbon catabolite repression 4-like (S. cerevisiae)
  • CCR4 protein homolog
  • CCR4-like (carbon catabolite repression 4, S.cerevisiae)
  • CCR4LMGC142060
  • CCR4MGC4120817
  • MGC142054
  • MGC78549
  • NOC
  • nocturnin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
6507-IL/CF
Species: Hu
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-98337
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-62689
Species: Hu
Applications: IHC, IHC-P
MAB197
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB150
Species: Hu
Applications: Flow, IHC, CyTOF-ready
MAB1429
Species: Hu
Applications: Flow, Neut

Publications for Nocturnin Antibody (NBP2-37939) (0)

There are no publications for Nocturnin Antibody (NBP2-37939).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nocturnin Antibody (NBP2-37939) (0)

There are no reviews for Nocturnin Antibody (NBP2-37939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nocturnin Antibody (NBP2-37939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nocturnin Products

Bioinformatics Tool for Nocturnin Antibody (NBP2-37939)

Discover related pathways, diseases and genes to Nocturnin Antibody (NBP2-37939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nocturnin Antibody (NBP2-37939)

Discover more about diseases related to Nocturnin Antibody (NBP2-37939).
 

Pathways for Nocturnin Antibody (NBP2-37939)

View related products by pathway.

Blogs on Nocturnin

There are no specific blogs for Nocturnin, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nocturnin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCRN4L
Uniprot