ADAM11 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit ADAM11 Antibody - Azide and BSA Free (NBP2-92621) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human ADAM11 (NP_002381.2). METWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAM11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
| Theoretical MW |
83 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for ADAM11 Antibody - Azide and BSA Free
Background
ADAM11, or Disintegrin and metalloproteinase domain-containing protein 11, contains a long 83 kDa isoform and a short 58 kDa isoform, and is involved in an assortment of biological processes consisting of cell-cell or cell-matrix interactions. Disease research is currently being studied with ADAM11 and its relation to breast, pancreatic, and prostate cancer, as well as pancreatitis, prostatitis, neuronitis, and alcoholism. This protein has been linked to the integrin-mediated signaling pathway where it interacts with STC2 and YWHAB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for ADAM11 Antibody (NBP2-92621) (0)
There are no publications for ADAM11 Antibody (NBP2-92621).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM11 Antibody (NBP2-92621) (0)
There are no reviews for ADAM11 Antibody (NBP2-92621).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADAM11 Antibody (NBP2-92621) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAM11 Products
Research Areas for ADAM11 Antibody (NBP2-92621)
Find related products by research area.
|
Blogs on ADAM11