ADAM11 Antibody - Azide and BSA Free

Images

 
Western Blot: ADAM11 Antibody [NBP2-92621] - Analysis of extracts of various cell lines, using ADAM11 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: ADAM11 Antibody [NBP2-92621] - Analysis of NIH/3T3 cells using ADAM11 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ADAM11 Antibody [NBP2-92621] - Analysis of C6 cells using ADAM11 at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ADAM11 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human ADAM11 (NP_002381.2). METWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for ADAM11 Antibody - Azide and BSA Free

  • a disintegrin and metalloproteinase domain 11
  • ADAM metallopeptidase domain 11
  • disintegrin and metalloproteinase domain-containing protein 11
  • MDCADAM 11
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein

Background

ADAM11, or Disintegrin and metalloproteinase domain-containing protein 11, contains a long 83 kDa isoform and a short 58 kDa isoform, and is involved in an assortment of biological processes consisting of cell-cell or cell-matrix interactions. Disease research is currently being studied with ADAM11 and its relation to breast, pancreatic, and prostate cancer, as well as pancreatitis, prostatitis, neuronitis, and alcoholism. This protein has been linked to the integrin-mediated signaling pathway where it interacts with STC2 and YWHAB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMD00
Species: Hu
Applications: ELISA
MCC170
Species: Mu
Applications: ELISA
MAB1567
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DIP100
Species: Hu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DRN00B
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
MME00
Species: Mu
Applications: ELISA
DCX900
Species: Hu
Applications: ELISA
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DY413
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for ADAM11 Antibody (NBP2-92621) (0)

There are no publications for ADAM11 Antibody (NBP2-92621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM11 Antibody (NBP2-92621) (0)

There are no reviews for ADAM11 Antibody (NBP2-92621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADAM11 Antibody (NBP2-92621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM11 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM11