| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human NLRP3/NALP3 Source: Wheat Germ (in vitro) Amino Acid Sequence: MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNAR |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | NLRP3 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01)Find related products by research area.
|
|
The NLRP3 Inflammasome: Macrophage Activator & Pathology Driver By Victoria Osinski, PhDWhat is the NLRP3 Inflammasome?With its critical role in innate immunity, the nucleotide-binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome ... Read full blog post. |
|
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T... Read full blog post. |
|
NLRP3/NALP3 - Sensing and responding to pathogen infection The inflammasome is a multi protein complex that is an important component of the innate immune response. The inflammasome is able to sense and respond to pathogen infections by recognizing pathogen-associated molecular patterns and mediating the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NLRP3 |