Recombinant Human NLRP3/NALP3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NLRP3/NALP3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human NLRP3/NALP3

Source: Wheat Germ

Amino Acid Sequence: MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNAR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NLRP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NLRP3/NALP3 Protein

  • AGTAVPRL
  • AII
  • AII/AVP
  • Angiotensin/vasopressin receptor AII/AVP-like
  • AVP
  • C1orf7
  • Caterpiller protein 1.1
  • CIAS1
  • CLR1.1
  • Cold autoinflammatory syndrome 1 protein
  • Cold autoinflammatory syndrome 1
  • Cryopyrin
  • Familial cold autoinflammatory syndrome
  • FCAS
  • FCU
  • Leucine-rich repeat-, and PYD-containing protein 3
  • Muckle-Wells syndrome
  • MWS
  • NACHT
  • NACHT, LRR and PYD containing protein 3
  • NACHT, LRR and PYD domains-containing protein 3
  • NALP3
  • NLR family, pyrin domain containing 3
  • NLRP3
  • Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 3
  • PYPAF1
  • PYRIN-containing APAF1-like protein 1

Background

CIAS1 - cold autoinflammatory syndrome 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
9134-TN
Species: Hu
7570-GH
Species: Hu
H00114548-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01) (0)

There are no publications for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01) (0)

There are no reviews for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01). (Showing 1 - 3 of 3 FAQ).

  1. Are the NLRP3/NALP3 antibodies validated in Simple Western?
    • Yes, we offer a NLRP3/NALP3 antibody that have been tested in Simple Western: NBP2-03948.
  2. Does NLRP3/NALP3 antibodies come in lyophilized form?
    • Yes, we carry 3 NLRP2 antibodies in lyophilized format: AF6789, AF7010, MAB6789, MAB7578.
  3. What is the theoretical molecular weight for NLRP3/NALP3 antibodies?
    • The TMW of NLRP3/NALP3 antibodies is approximately 118 kDa.

Additional NLRP3/NALP3 Products

Bioinformatics Tool for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01)

Discover related pathways, diseases and genes to NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01)

Discover more about diseases related to NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01).
 

Pathways for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01)

View related products by pathway.

PTMs for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01)

Learn more about PTMs related to NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01).
 

Research Areas for NLRP3/NALP3 Partial Recombinant Protein (H00114548-Q01)

Find related products by research area.

Blogs on NLRP3/NALP3.

NLRP3/NALP3 - Sensing and responding to pathogen infection
The inflammasome is a multi protein complex that is an important component of the innate immune response. The inflammasome is able to sense and respond to pathogen infections by recognizing pathogen-associated molecular patterns and mediating the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NLRP3/NALP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP3
Entrez