NG2/MCSP Antibody

Images

 
Western Blot: NG2/MCSP Antibody [NBP1-89682] - Analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.
Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NG2/MCSP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSPG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NG2/MCSP Protein (NBP1-89682PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NG2/MCSP Antibody

  • AN2
  • chondroitin sulfate proteoglycan 4 (melanoma-associated)
  • chondroitin sulfate proteoglycan 4
  • CSPG4
  • EC 3.6.3
  • HMW-MAA
  • MCSP
  • MCSPChondroitin sulfate proteoglycan NG2
  • MCSPG
  • MCSPGMelanoma chondroitin sulfate proteoglycan
  • MEL-CSPG
  • MSK16Melanoma-associated chondroitin sulfate proteoglycan
  • NG2
  • NG2EC 2.7.8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP2-48653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF5800
Species: Mu, Rt
Applications: WB, IHC
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
MAB2688
Species: Hu
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for NG2/MCSP Antibody (NBP1-89682) (0)

There are no publications for NG2/MCSP Antibody (NBP1-89682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NG2/MCSP Antibody (NBP1-89682) (0)

There are no reviews for NG2/MCSP Antibody (NBP1-89682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NG2/MCSP Antibody (NBP1-89682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NG2/MCSP Products

Bioinformatics Tool for NG2/MCSP Antibody (NBP1-89682)

Discover related pathways, diseases and genes to NG2/MCSP Antibody (NBP1-89682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NG2/MCSP Antibody (NBP1-89682)

Discover more about diseases related to NG2/MCSP Antibody (NBP1-89682).
 

Pathways for NG2/MCSP Antibody (NBP1-89682)

View related products by pathway.

PTMs for NG2/MCSP Antibody (NBP1-89682)

Learn more about PTMs related to NG2/MCSP Antibody (NBP1-89682).

Blogs on NG2/MCSP

There are no specific blogs for NG2/MCSP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NG2/MCSP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSPG4
Entrez
Uniprot