NG2/MCSP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NG2/MCSP Antibody [NBP1-89682] - Immunofluorescence (IF) analysis of NG2/CSPG4 expression in glioblastoma (GB)-derived human cell lines. IF of a GB-derived neurosphere cell line for (A) NG2/CSPG4 (green), original magnification (OM) ×200; (B) Nestin (red), OM ×200; (C) MSel1 (red), OM ×200; (D) Notch-2 (green), OM ×200. IF staining of an adherent cell line for (E) NG2/CSPG4 (green), OM ×400; (F) GFAP (green), OM ×400; (G) beta -III Tubulin (red), OM ×200; (H) Galactocerebroside C (red), OM ×200. Nuclei were counterstained with DAPI (blue). DAPI, 4′,6-diamidino-2-phenylindole. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32599896), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunocytochemistry/ Immunofluorescence: NG2/MCSP Antibody [NBP1-89682] - Immunofluorescence (IF) analysis of NG2/CSPG4 expression in glioblastoma (GB)-derived human cell lines. IF of a GB-derived neurosphere cell line for (A) NG2/CSPG4 (green), original magnification (OM) ×200; (B) Nestin (red), OM ×200; (C) MSel1 (red), OM ×200; (D) Notch-2 (green), OM ×200. IF staining of an adherent cell line for (E) NG2/CSPG4 (green), OM ×400; (F) GFAP (green), OM ×400; (G) beta -III Tubulin (red), OM ×200; (H) Galactocerebroside C (red), OM ×200. Nuclei were counterstained with DAPI (blue). DAPI, 4′,6-diamidino-2-phenylindole. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32599896), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

NG2-MCSP-Antibody-Immunohistochemistry-NBP1-89682-img0010.jpg

NG2-MCSP-Antibody-Immunohistochemistry-NBP1-89682-img0011.jpg

Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.

Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NG2/MCSP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NG2/MCSP Antibody - BSA Free (NBP1-89682) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NG2/MCSP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSPG4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NG2/MCSP Protein (NBP1-89682PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NG2/MCSP Antibody - BSA Free

• AN2
• chondroitin sulfate proteoglycan 4 (melanoma-associated)
• chondroitin sulfate proteoglycan 4
• CSPG4
• EC 3.6.3
• HMW-MAA
• MCSP
• MCSPChondroitin sulfate proteoglycan NG2
• MCSPG
• MCSPGMelanoma chondroitin sulfate proteoglycan
• MEL-CSPG
• MSK16Melanoma-associated chondroitin sulfate proteoglycan
• NG2
• NG2EC 2.7.8

Background

Proteoglycans (PGs) are a family of proteins composed of different polypeptide chains containing glycosaminoglycan (GAG) modifications. They vary in their cellular locations and have diverse structure and functions. NG2 is a proteoglycan found in the nervous system, comprising a large integral membrane PG with a core protein of 300 kDa and at least one covalently attached chondroitin sulfate (CS) GAG chain. In the CNS this protein is expressed mainly on the surfaces of developing and adult oligodendrocyte precursor cells, but is also associated with developing chondrocytes, cardiomyocytes, pericytes and several human tumours.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NG2/MCSP Antibody (NBP1-89682)(1)

Publication using NBP1-89682

• Mellai M, Annovazzi L, Bisogno I et al. Chondroitin Sulphate Proteoglycan 4 (NG2/CSPG4) Localization in Low- and High-Grade Gliomas Cells 2020-06-24 [PMID: 32599896] (Human)

Bioinformatics

• Gene Symbol: CSPG4
• Entrez:
  • 1464(Human)
• Uniprot:
  • Q6UVK1()