MBP-1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MBP-1 Antibody - BSA Free (NBP3-04784) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBP-1 (NP_002719.3). GIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVAL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 -1:200
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.09% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MBP-1 Antibody - BSA Free
Background
PRG2, also known as Bone marrow proteoglycan, is a 222 amino acid protein that is 25 kDa, found in high levels of the proform in placenta and pregnancy serum, may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions; is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases; and the proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Disease research is currently being studied in relation to PRG2 and malignant peripheral nerve sheath tumor, epithelioid malignant peripheral nerve sheath tumor, ocular cicatricial pemphigoid, cicatricial pemphigoid, giant papillary conjunctivitis, vernal keratoconjunctivitis, corneal ulcer, allergic rhinitis, eosinophilic gastroenteritis, papillary conjunctivitis, hypereosinophilic syndrome, eosinophilia, pulmonary eosinophilia,connective tissue disease, kimura disease, rhinitis, retinal detachment, keratoconjunctivitis, eosinophilic esophagitis, and familial eosinophilia. The protein has been shown to interact with CHD3, PAPPA, PRKCZ, AGT, CSF2, and other proteins in MAPK Signaling, Molecular Mechanisms of Cancer, PTEN Pathway, Transendothelial Migration of Leukocytes, UPA-UPAR Pathway, Selected targets of C/EBPbeta and Asthma pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Rt
Applications: BA
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MBP-1 Antibody (NBP3-04784) (0)
There are no publications for MBP-1 Antibody (NBP3-04784).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MBP-1 Antibody (NBP3-04784) (0)
There are no reviews for MBP-1 Antibody (NBP3-04784).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBP-1 Antibody (NBP3-04784) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MBP-1 Products
Research Areas for MBP-1 Antibody (NBP3-04784)
Find related products by research area.
|
Blogs on MBP-1