ZNF654 Antibody

Images

 
Genetic Strategies: Western Blot: ZNF654 Antibody [NBP2-48653] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: ZNF654 Antibody [NBP2-48653] - Staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: ZNF654 Antibody [NBP2-48653] - Staining of human testis shows strong nuclear positivity in a subset of seminiferous ducts cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ZNF654 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QEVTALEEINCSSSSISFENGNSDSKDLEVETLTASSEGNKEVIPEHVAEFIEIPISVPEDVIENVIENGSPNNSLNNVFKPLTECGDDYE
Specificity
Specificity of human ZNF654 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF654
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF654 Recombinant Protein Antigen (NBP2-48653PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF654 Antibody

  • FLJ10997
  • FLJ21142
  • zinc finger protein 654

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
7268-CT
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, IHC-P (-)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, ICC/IF, IP, Flow-IC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
796-IC
Species: Mu
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF654 Antibody (NBP2-48653) (0)

There are no publications for ZNF654 Antibody (NBP2-48653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF654 Antibody (NBP2-48653) (0)

There are no reviews for ZNF654 Antibody (NBP2-48653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF654 Antibody (NBP2-48653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF654 Antibody (NBP2-48653)

Discover related pathways, diseases and genes to ZNF654 Antibody (NBP2-48653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF654 Antibody (NBP2-48653)

Discover more about diseases related to ZNF654 Antibody (NBP2-48653).

Blogs on ZNF654

There are no specific blogs for ZNF654, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF654 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF654