Neutrophil Elastase/ELA2 Antibody (8X4E6)

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724] - Analysis of extracts of various cell lines, using Neutrophil Elastase/ELA2 antibody (NBP3-16724) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IP
• Clone: 8X4E6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Neutrophil Elastase/ELA2 Antibody (8X4E6) Summary

• Description: Novus Biologicals Rabbit Neutrophil Elastase/ELA2 Antibody (8X4E6) (NBP3-16724) is a recombinant monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246). SVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ELANE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1ug/mL
  • Immunoprecipitation 5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neutrophil Elastase/ELA2 Antibody (8X4E6)

• Bone marrow serine protease
• EC 3.4.21
• EC 3.4.21.37
• ELA2
• ELA2granulocyte-derived elastase
• ELANE
• elastase 2, neutrophil
• elastase, neutrophil expressed
• Elastase-2
• GE
• HLEelastase-2
• HNE
• Human leukocyte elastase
• Leukocyte Elastase
• Medullasin
• NE
• Neutrophil Elastase
• PMN elastase
• PMN-E
• polymorphonuclear elastase
• SCN1

Background

The ELANE gene (commonly known as neutrophil elastase) encodes a 267 amino acid long, 28 kDA neutrophil elastase protein that functions in regulation of natural killer cells, monocytes, and graulocytes. ELANE is involved in activation of proMMP8, cell adhesion cell-matrix glycoconjugates, selected targets of C/EBPbeta, degradation of the extracellular matrix and collagen, and amb2 integrin signaling. It interacts with various genes GZMB, LRP1, SERPINF2, SERPING1, and SERPINA1. Elane has been linked to cystic fibrosis, asthma, pneumonia, alzheimer's disease, neutropenia, cutis laxia, leg ulcers, wegener's granulomatosis, bronchitis, adult respiratory distress syndrome, and vascular diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELANE