NAC1 Antibody

Images

 
Genetic Strategies: Western Blot: NAC1 Antibody [NBP2-49361] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: NAC1 Antibody [NBP2-49361] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NAC1 Antibody [NBP2-49361] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

NAC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NACC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAC1 Recombinant Protein Antigen (NBP2-49361PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAC1 Antibody

  • BEND8
  • BTB (POZ) domain containing 14B
  • BTB/POZ domain-containing protein 14B
  • BTBD14B
  • BTBD30
  • NAC1
  • NAC1BEN domain containing 8
  • NAC-1FLJ37383
  • NACC1
  • nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
  • nucleus accumbens-associated protein 1
  • transcriptional repressor NAC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP3-17823
Species: Hu
Applications: ELISA, ICC, ICC/IF, IHC, IHC-P, WB
NB100-836
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-22151
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-02577
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00388112-B01P
Species: Hu
Applications: WB
MAB163
Species: Hu
Applications: IHC, WB
AF2944
Species: Hu
Applications: Simple Western, WB
NBP2-49361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for NAC1 Antibody (NBP2-49361) (0)

There are no publications for NAC1 Antibody (NBP2-49361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAC1 Antibody (NBP2-49361) (0)

There are no reviews for NAC1 Antibody (NBP2-49361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NAC1 Antibody (NBP2-49361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAC1 Products

Array NBP2-49361

Bioinformatics Tool for NAC1 Antibody (NBP2-49361)

Discover related pathways, diseases and genes to NAC1 Antibody (NBP2-49361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAC1 Antibody (NBP2-49361)

Discover more about diseases related to NAC1 Antibody (NBP2-49361).
 

Pathways for NAC1 Antibody (NBP2-49361)

View related products by pathway.

PTMs for NAC1 Antibody (NBP2-49361)

Learn more about PTMs related to NAC1 Antibody (NBP2-49361).
 

Research Areas for NAC1 Antibody (NBP2-49361)

Find related products by research area.

Blogs on NAC1

There are no specific blogs for NAC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NACC1