PSMD7 Antibody

Images

 
Independent Antibodies: Western Blot: PSMD7 Antibody [NBP2-38780] - Analysis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar pattern to independent antibody NBP2-38612 (B).
Immunocytochemistry/ Immunofluorescence: PSMD7 Antibody [NBP2-38780] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human kidney.
Immunohistochemistry: PSMD7 Antibody [NBP2-38780] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
Independent Antibodies: Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human testis.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PSMD7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK
Specificity
Specificity of human PSMD7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMD7 Antibody

  • 26S proteasome non-ATPase regulatory subunit 7
  • 26S proteasome regulatory subunit RPN8
  • Moloney leukemia virus-34 proviral integration
  • Mov34 homolog
  • Mov34 protein homolog
  • MOV3426S proteasome regulatory subunit S12
  • MOV34L
  • P40
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog)
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
  • Proteasome subunit p40
  • Rpn8
  • S12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP2-85667
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-38780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PSMD7 Antibody (NBP2-38780) (0)

There are no publications for PSMD7 Antibody (NBP2-38780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD7 Antibody (NBP2-38780) (0)

There are no reviews for PSMD7 Antibody (NBP2-38780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD7 Antibody (NBP2-38780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PSMD7 Products

Bioinformatics Tool for PSMD7 Antibody (NBP2-38780)

Discover related pathways, diseases and genes to PSMD7 Antibody (NBP2-38780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD7 Antibody (NBP2-38780)

Discover more about diseases related to PSMD7 Antibody (NBP2-38780).
 

Pathways for PSMD7 Antibody (NBP2-38780)

View related products by pathway.

PTMs for PSMD7 Antibody (NBP2-38780)

Learn more about PTMs related to PSMD7 Antibody (NBP2-38780).

Blogs on PSMD7

There are no specific blogs for PSMD7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD7
Uniprot
COVID-19 update