PSMD7 Antibody


Independent Antibodies: Western Blot: PSMD7 Antibody [NBP2-38780] - Analysis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar pattern to independent antibody NBP2-38612 (B).
Immunocytochemistry/ Immunofluorescence: PSMD7 Antibody [NBP2-38780] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human kidney.
Immunohistochemistry: PSMD7 Antibody [NBP2-38780] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
Independent Antibodies: Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar protein more
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human testis.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human colon.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

PSMD7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMD7 Protein (NBP2-38780PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PSMD7 Antibody

  • 26S proteasome non-ATPase regulatory subunit 7
  • 26S proteasome regulatory subunit RPN8
  • Moloney leukemia virus-34 proviral integration
  • Mov34 homolog
  • Mov34 protein homolog
  • MOV3426S proteasome regulatory subunit S12
  • MOV34L
  • P40
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34 homolog)
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
  • Proteasome subunit p40
  • Rpn8
  • S12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IP, S-ELISA, WB

Publications for PSMD7 Antibody (NBP2-38780) (0)

There are no publications for PSMD7 Antibody (NBP2-38780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD7 Antibody (NBP2-38780) (0)

There are no reviews for PSMD7 Antibody (NBP2-38780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD7 Antibody (NBP2-38780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PSMD7 Products

Bioinformatics Tool for PSMD7 Antibody (NBP2-38780)

Discover related pathways, diseases and genes to PSMD7 Antibody (NBP2-38780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD7 Antibody (NBP2-38780)

Discover more about diseases related to PSMD7 Antibody (NBP2-38780).

Pathways for PSMD7 Antibody (NBP2-38780)

View related products by pathway.

PTMs for PSMD7 Antibody (NBP2-38780)

Learn more about PTMs related to PSMD7 Antibody (NBP2-38780).

Blogs on PSMD7

There are no specific blogs for PSMD7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PSMD7 Antibody and receive a gift card or discount.


Gene Symbol PSMD7