Recombinant Human ATP5G3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ATP5G3 Protein [H00000518-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human ATP5G3 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 142 of Human ATP5G3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ATP5G3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
41.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP5G3 GST (N-Term) Protein

  • ATP synthase lipid-binding protein, mitochondrial
  • ATP synthase proteolipid P3
  • ATP synthase subunit 9
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)isoform 3
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9)
  • ATP synthase, mitochondrial, C subunit-3
  • ATPase protein 9
  • ATPase subunit c
  • MGC125738
  • P3

Background

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-62583
Species: Hu
Applications: WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-01264
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: IHC, IHC-P
NBP1-84798
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-59875
Species: Hu
Applications: WB

Publications for ATP5G3 Recombinant Protein (H00000518-P01) (0)

There are no publications for ATP5G3 Recombinant Protein (H00000518-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5G3 Recombinant Protein (H00000518-P01) (0)

There are no reviews for ATP5G3 Recombinant Protein (H00000518-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5G3 Recombinant Protein (H00000518-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP5G3 Products

Array H00000518-P01

Diseases for ATP5G3 Recombinant Protein (H00000518-P01)

Discover more about diseases related to ATP5G3 Recombinant Protein (H00000518-P01).
 

Pathways for ATP5G3 Recombinant Protein (H00000518-P01)

View related products by pathway.

Blogs on ATP5G3

There are no specific blogs for ATP5G3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP5G3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5G3