CRIF1 Antibody


Western Blot: CRIF1 Antibody [NBP2-39045] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry: CRIF1 Antibody [NBP2-39045] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CRIF1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Specificity of human CRIF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRIF1 Protein (NBP2-39045PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CRIF1 Antibody

  • CKBBP2
  • CKII beta-associating protein
  • CR6 interacting factor 1
  • CRIF1p53-responsive gene 6 protein
  • growth arrest and DNA damage-inducible proteins-interacting protein 1
  • growth arrest and DNA-damage-inducible, gamma interacting protein 1
  • MGC4667
  • MGC4758
  • papillomavirus L2 interacting nuclear protein 1
  • Papillomavirus L2-interacting nuclear protein 1
  • Plinp1
  • PLINP-1CKII beta binding protein 2
  • PRG6CR6-interacting factor 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western

Publications for CRIF1 Antibody (NBP2-39045) (0)

There are no publications for CRIF1 Antibody (NBP2-39045).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRIF1 Antibody (NBP2-39045) (0)

There are no reviews for CRIF1 Antibody (NBP2-39045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRIF1 Antibody (NBP2-39045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CRIF1 Antibody (NBP2-39045)

Discover related pathways, diseases and genes to CRIF1 Antibody (NBP2-39045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRIF1 Antibody (NBP2-39045)

Discover more about diseases related to CRIF1 Antibody (NBP2-39045).

Pathways for CRIF1 Antibody (NBP2-39045)

View related products by pathway.

PTMs for CRIF1 Antibody (NBP2-39045)

Learn more about PTMs related to CRIF1 Antibody (NBP2-39045).

Blogs on CRIF1

There are no specific blogs for CRIF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CRIF1 Antibody and receive a gift card or discount.


Gene Symbol GADD45GIP1