![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0004.jpg "Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLCO6A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NB300-731-img0019.jpg)
-Flow-Cytometry-NB300-731-img0018.jpg)
-Immunocytochemistry-Immunofluorescence-NB300-731-img0014.jpg)
-Flow-Cytometry-NB200-209-img0017.jpg)
-Flow-Cytometry-NB200-209-img0018.jpg)
-Western-Blot-NB200-209-img0019.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for SLCO6A1 Antibody (NBP2-49118)Discover more about diseases related to SLCO6A1 Antibody (NBP2-49118).
| Pathways for SLCO6A1 Antibody (NBP2-49118)View related products by pathway.
|
Research Areas for SLCO6A1 Antibody (NBP2-49118)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLCO6A1 |
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0003.jpg "Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0005.jpg "Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
-Western-Blot-H00002946-M03-img0005.jpg)
-Immunocytochemistry-Immunofluorescence-H00002946-M03-img0002.jpg)
-Immunohistochemistry-Paraffin-H00002946-M03-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-74398-img0001.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-74398-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-74398-img0003.jpg)
-Western-Blot-H00002938-M01-img0007.jpg)
-Immunohistochemistry-Paraffin-H00002938-M01-img0005.jpg)
-Sandwich-ELISA-H00002938-M01-img0006.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")