NAC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NAC1 Antibody [NBP1-89991] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Staining of human cerebral cortex, duodenum, skin and testis using Anti-NACC1 antibody NBP1-89991 (A) shows similar protein distribution across tissues to independent antibody NBP2-49361 (B).

Staining of human skin shows strong cytoplasmic-nuclear positivity in squamous epithelial cells.

Staining of human duodenum shows strong cytoplasmic-nuclear positivity in glandular cells.

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NAC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NAC1 Antibody - BSA Free (NBP1-89991) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCH
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NACC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NAC1 Protein (NBP1-89991PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NAC1 Antibody - BSA Free

• BEND8
• BTB (POZ) domain containing 14B
• BTB/POZ domain-containing protein 14B
• BTBD14B
• BTBD30
• NAC1
• NAC1BEN domain containing 8
• NAC-1FLJ37383
• NACC1
• nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
• nucleus accumbens-associated protein 1
• transcriptional repressor NAC1

Background

The BTB/POZ gene family shares a conserved BTB/POZ protein-protein interaction motif at the N terminus that mediates homodimer or heterodimer formation. NAC1, a member of this family, has been found to be overexpressed in ovarian cancer. This protein appears to play a critical role in tumorigenesis and in the growth and survival of tumor cells, and Nac1 antibodies are therefore useful for cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NACC1