NAC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAC1 Antibody [NBP1-89991] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: NAC1 Antibody [NBP1-89991] - Staining of human esophagus shows nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NACC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAC1 Protein (NBP1-89991PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAC1 Antibody

  • BEND8
  • BTB (POZ) domain containing 14B
  • BTB/POZ domain-containing protein 14B
  • BTBD14B
  • BTBD30
  • NAC1
  • NAC1BEN domain containing 8
  • NAC-1FLJ37383
  • NACC1
  • nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
  • nucleus accumbens-associated protein 1
  • transcriptional repressor NAC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-39045
Species: Hu
Applications: WB, IHC, IHC-P
NB100-836
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-89991
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for NAC1 Antibody (NBP1-89991) (0)

There are no publications for NAC1 Antibody (NBP1-89991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAC1 Antibody (NBP1-89991) (0)

There are no reviews for NAC1 Antibody (NBP1-89991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NAC1 Antibody (NBP1-89991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAC1 Products

NAC1 NBP1-89991

Bioinformatics Tool for NAC1 Antibody (NBP1-89991)

Discover related pathways, diseases and genes to NAC1 Antibody (NBP1-89991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAC1 Antibody (NBP1-89991)

Discover more about diseases related to NAC1 Antibody (NBP1-89991).
 

Pathways for NAC1 Antibody (NBP1-89991)

View related products by pathway.

PTMs for NAC1 Antibody (NBP1-89991)

Learn more about PTMs related to NAC1 Antibody (NBP1-89991).
 

Research Areas for NAC1 Antibody (NBP1-89991)

Find related products by research area.

Blogs on NAC1

There are no specific blogs for NAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NACC1
Entrez