Musculin Antibody

Images

 
Western Blot: Musculin Antibody [NBP2-56244] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Musculin Antibody [NBP2-56244] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Musculin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS
Specificity
Specificity of human Musculin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Musculin Recombinant Protein Antigen (NBP2-56244PEP)

Reactivity Notes

Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Musculin Antibody

  • ABF1
  • ABF-1activated B-cell factor 1, homolog of mouse musculin
  • Activated B-cell factor 1
  • BHLHA22
  • bHLHa22activated B-cell factor-1
  • Class A basic helix-loop-helix protein 22
  • musculin (activated B-cell factor-1)
  • musculin
  • MYOR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-65543
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for Musculin Antibody (NBP2-56244) (0)

There are no publications for Musculin Antibody (NBP2-56244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Musculin Antibody (NBP2-56244) (0)

There are no reviews for Musculin Antibody (NBP2-56244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Musculin Antibody (NBP2-56244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Musculin Products

Bioinformatics Tool for Musculin Antibody (NBP2-56244)

Discover related pathways, diseases and genes to Musculin Antibody (NBP2-56244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Musculin Antibody (NBP2-56244)

Discover more about diseases related to Musculin Antibody (NBP2-56244).
 

Pathways for Musculin Antibody (NBP2-56244)

View related products by pathway.

PTMs for Musculin Antibody (NBP2-56244)

Learn more about PTMs related to Musculin Antibody (NBP2-56244).

Blogs on Musculin

There are no specific blogs for Musculin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Musculin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSC