5'-Nucleotidase/CD73 Antibody

Images

 
Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.
Immunocytochemistry/ Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong membranous positivity in glandular cells.
Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human aortic valve staining for CD73. Image from verified customer review.
Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for pig aortic valve. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Po, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5'-Nucleotidase/CD73 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:100-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Not recommended for FLOW.
Control Peptide
5'-Nucleotidase/CD73 Protein (NBP1-85740PEP)
Reviewed Applications
Read 4 Reviews rated 4.5
using
NBP1-85740 in the following applications:

Publications
Read Publications using
NBP1-85740 in the following applications:

  • WB
    3 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21998208). CD73 staining for pig aortic valve. Image from verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5'-Nucleotidase/CD73 Antibody

  • 5' nucleotidase (CD73)
  • 5'-NT
  • 5-NT
  • 5'Nucleotidase
  • 5'-Nucleotidase
  • 5'-nucleotidase, ecto (CD73)
  • CD73 antigen
  • CD73
  • E5NT
  • EC 3.1.3.5
  • ecto-5'-nucleotidase
  • eN
  • eNT
  • NT
  • NT55'-nucleotidase
  • NT5E
  • NTE
  • Purine 5-Prime-Nucleotidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)(6)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for 5'-Nucleotidase/CD73 Antibody (NBP1-85740) (4) 4.54

Average Rating: 4.5
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Other.
We have 4 reviews tested in 4 application: WB, IF, ICC, IHC-P.

Reviews using NBP1-85740:
Filter by Applications
WB
(1)
IF
(1)
ICC
(1)
IHC-P
(1)
All Applications
Filter by Species
Human
(3)
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot 5'-Nucleotidase/CD73 NBP1-85740
Enlarge
reviewed by:
Ewa Kaniewska
WB Human 05/13/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
LotA81346
FileView PDF
Immunofluorescence 5'-Nucleotidase/CD73 NBP1-85740
Enlarge
reviewed by:
Ewa Kaniewska
IF Human 04/13/2014
View

Summary

ApplicationImmunofluorescence
SpeciesHuman
LotA40214
FileView PDF
Immunocytochemistry 5'-Nucleotidase/CD73 NBP1-85740
Enlarge
reviewed by:
Ewa Kaniewska
ICC Other 03/27/2014
View

Summary

ApplicationImmunocytochemistry
SpeciesOther
FileView PDF
Immunohistochemistry-Paraffin 5'-Nucleotidase/CD73 NBP1-85740
Enlarge
reviewed by:
Ewa Kaniewska
IHC-P Human 03/27/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
SpeciesHuman
LotA40214
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 5'-Nucleotidase/CD73 Antibody (NBP1-85740). (Showing 1 - 1 of 1 FAQs).

  1. We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Secondary Antibodies

 

Isotype Controls

Additional 5'-Nucleotidase/CD73 Products

Bioinformatics Tool for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)

Discover related pathways, diseases and genes to 5'-Nucleotidase/CD73 Antibody (NBP1-85740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)

Discover more about diseases related to 5'-Nucleotidase/CD73 Antibody (NBP1-85740).
 

Pathways for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)

View related products by pathway.

PTMs for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)

Learn more about PTMs related to 5'-Nucleotidase/CD73 Antibody (NBP1-85740).
 

Research Areas for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)

Find related products by research area.

Blogs on 5'-Nucleotidase/CD73.

CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase)
CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
2
4
2
3
0
2
0
1
0

Ewa Kaniewska
05/13/2014
Application: WB
Species: Human

Ewa Kaniewska
04/13/2014
Application: IF
Species: Human

Ewa Kaniewska
03/27/2014
Application: ICC
Species: Other

Bioinformatics

Gene Symbol NT5E
Entrez
Uniprot