MNX1/HLXB9 Antibody (9P1B7) Summary
| Description |
Novus Biologicals Rabbit MNX1/HLXB9 Antibody (9P1B7) (NBP3-15861) is a recombinant monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MNX1/HLXB9 (P50219). SQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
MNX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:1000 - 1:5000
|
| Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MNX1/HLXB9 Antibody (9P1B7)
Background
The homeobox gene Hb9/Hlxb9, is expressed selectively by motor neurons (MNs) in the developing vertebrate CNS. Hb9, which encodes a factor central to MN development regulates neuronal fate by restricting expression of Lim3 and Even-skipped (Eve), two homeodomain (HD) proteins required for development of distinct neuronal classes. In the vertebrate CNS, HB9/MNR2 transcription factors are specifically expressed in all somatic motoneurons and are necessary to distinguish motoneurons from interneurons. Hb9 is also a transcription factor expressed in lymphoid and pancreatic tissue. In humans, HB9 mutation causes an autosomal dominant form of sacral agenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB, ELISA
Publications for MNX1/HLXB9 Antibody (NBP3-15861) (0)
There are no publications for MNX1/HLXB9 Antibody (NBP3-15861).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MNX1/HLXB9 Antibody (NBP3-15861) (0)
There are no reviews for MNX1/HLXB9 Antibody (NBP3-15861).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MNX1/HLXB9 Antibody (NBP3-15861) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MNX1/HLXB9 Products
Research Areas for MNX1/HLXB9 Antibody (NBP3-15861)
Find related products by research area.
|
Blogs on MNX1/HLXB9