ETV6/Tel Antibody

Images

 
Orthogonal Strategies: Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell lines U2OS and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: ETV6/Tel Antibody [NBP1-80695] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human kidney shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining in human breast and kidney tissues using anti-ETV6 antibody. Corresponding ETV6 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human skin shows weak nuclear positivity in keratinocytes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ETV6/Tel Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR
Specificity
Specificity of human ETV6/Tel antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25807284). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Human Appendix Whole Tissue Lysate (Adult Whole Liver Cirrhosis)
ETV6/Tel Knockout A549 Cell Lysate
Control Peptide
Publications
Read Publications using
NBP1-80695 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%). Human reactivity reported in scientific literature (PMID: 25807284).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ETV6/Tel Antibody

  • ETS translocation variant 6
  • ets variant 6
  • ets variant gene 6 (TEL oncogene)
  • ETS-related protein Tel1
  • ETV6
  • TEL
  • TEL/ABL
  • TEL1
  • TELTEL1 oncogene
  • transcription factor ETV6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67779
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-45545
Species: Hu
Applications: WB, IHC
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
AF5129
Species: Hu
Applications: WB
NBP1-62489
Species: Hu, Mu
Applications: WB
NB100-104
Species: Hu, Mu, Rt, Kg
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-59451
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1042
Species: Mu
Applications: WB, IHC
NBP2-55747
Species: Hu
Applications: WB, ICC/IF

Publications for ETV6/Tel Antibody (NBP1-80695)(2)

Reviews for ETV6/Tel Antibody (NBP1-80695) (0)

There are no reviews for ETV6/Tel Antibody (NBP1-80695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ETV6/Tel Antibody (NBP1-80695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ETV6/Tel Products

Bioinformatics Tool for ETV6/Tel Antibody (NBP1-80695)

Discover related pathways, diseases and genes to ETV6/Tel Antibody (NBP1-80695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV6/Tel Antibody (NBP1-80695)

Discover more about diseases related to ETV6/Tel Antibody (NBP1-80695).
 

Pathways for ETV6/Tel Antibody (NBP1-80695)

View related products by pathway.

PTMs for ETV6/Tel Antibody (NBP1-80695)

Learn more about PTMs related to ETV6/Tel Antibody (NBP1-80695).

Blogs on ETV6/Tel

There are no specific blogs for ETV6/Tel, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV6/Tel Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV6
Entrez
Uniprot
Novus 100% Guarantee