Home » ETV6/Tel » ETV6/Tel Antibodies » ETV6/Tel Antibody

ETV6/Tel Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining in human breast and kidney tissues using anti-ETV6 antibody. Corresponding ETV6 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining in human breast and kidney tissues using anti-ETV6 antibody. Corresponding ETV6 RNA-seq data are presented for the ...read more
Orthogonal Strategies: Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell lines U2OS and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: ETV6/Tel Antibody [NBP1-80695] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human skin shows weak nuclear positivity in keratinocytes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ETV6/Tel Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25807284). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Human Appendix Whole Tissue Lysate (Adult Whole Liver Cirrhosis)
Control Peptide
ETV6/Tel Protein (NBP1-80695PEP)
Publications
Read Publications using
NBP1-80695 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%). Human reactivity reported in scientific literature (PMID: 25807284).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ETV6/Tel Antibody

  • ETS translocation variant 6
  • ets variant 6
  • ets variant gene 6 (TEL oncogene)
  • ETS-related protein Tel1
  • ETV6
  • TEL
  • TEL/ABL
  • TEL1
  • TELTEL1 oncogene
  • transcription factor ETV6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Exosome component
1 Antibody (OTI1H9)
NBP2-45545
Immunohistochemistry: Exosome component 1 Antibody (1H9) [NBP2-45545] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: Exosome component 1 Antibody (1H9) [NBP2-45545] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: Exosome component 1 Antibody (1H9) [NBP2-45545] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu, Mu, Rt
Applications: IHC, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
Western Blot: ATR Antibody (2B5) [NB100-308] - Raji whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody diluted at 1:500.
(19 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
MTTP Antibody
NBP1-62489
Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western Chemiluminescence HRP substrate, imaged with Syngene imaging system. WB image submitted by a verified customer review.
Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate.
(1 Review)
(1 Publication)
Species: Dr, Hu, Mu
Applications: WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated: ATM Antibody (2C1) [NB100-309] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (60 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:500.
Knockdown Validated: ATM Antibody (2C1) [NB100-309] - Methylated EDSBs may be repaired by an ATM-dependent pathway. Immunoblots of ATM and DNA-PKcs in ATM shRNA-transfected HeLa cells, using ATM antibody (2C1) [NB100-309]. GAPDH is included as a loading control. Image collected and cropped by CiteAb from the following publication (http://molecular-cancer.biomedcentral.com/articles/10.1186/1476-4598-9-70), licensed under a CC-BY licence.
Immunoprecipitation: ATM Antibody (2C1) [NB100-309] - MDA-MB-231 whole cell lysates were immunoprecipitated with 2 ug ATM Antibody (NB100-309), followed by Western blot (primary antibody: NB100-309 at 1:1000, 4C overnight. Western blot image submitted by a verified customer review.
(3 Reviews)
(123 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Jak2 Antibody
(53B7)
NBP2-59451
Flow Cytometry: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cell line, antibody at 2 - 5 ug per 10^6cells (red line). Secondary antibody: goat anti-mouse IgG Alexa Fluor 488 conjugate. Isotype control antibody: mouse IgG (black line).
Immunocytochemistry/Immunofluorescence: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cells line, stained with DAPI (Blue) and anti-human JAK2 antibody at 1:100 with goat anti-mouse IgG Alexa Fluor 488 conjugate (Green).
Western Blot: Jak2 Antibody (53B7) [NBP2-59451] - Human breast cancer MCF7 cells were treated with control (Con) or Adenosine (Ado) and the expression of JAK2 was detected. Western blot image submitted by a verified customer review.
(3 Reviews)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
p19ARF/CDKN2A
Antibody
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(44 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(160 Publications)
Species: Hu
Applications: BA
Chk2 Antibody
(73C175.1.1)
NB100-56546
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - Western Blot: Chk2 Antibody (73C175.1.1) - Azide Free [NBP2-27403] - analysis of Chk2 in 293 cell lysate. A protein band of approximate molecular weight of 60-62 kDa is detected with Chk2 antibody at 2 ug/ml. Image using the Azide Free form of this antibody.
Immunocytochemistry/Immunofluorescence: Chk2 Antibody (73C175.1.1) [NB100-56546] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Chk2 (73C175.1.1) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: Chk2 Antibody (73C175.1.1) [NB100-56546] - An intracellular stain was performed on Hek293 cells with Chk2 [73C175.1.1] Antibody NB100-56546 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TrkC Antibody
[Unconjugated]
AF1404
Western blot shows lysates of mouse brain (cerebellum) tissue, mouse brain (cortex) tissue, and rat brain tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Mouse/Rat TrkC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1404) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for TrkC at approximately 100 and 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse brain tissue, loaded at 0.2 mg/mL. Specific bands were detected for TrkC at approximately 111 and 159 kDa (as indicated) using 25 µg/mL of Goat Anti-Mouse/Rat TrkC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1404) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(3 Reviews)
(35 Publications)
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
MMAB Antibody
(OTI2G5)
NBP2-03417
Flow Cytometry: MMAB Antibody (2G5) [NBP2-03417] - Analysis of Jurkat cells, using anti-MMAB antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: MMAB Antibody (2G5) [NBP2-03417] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-MMAB antibody, and then analyzed by flow cytometry.
Western Blot: MMAB Antibody (2G5) [NBP2-03417] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MMAB (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MMAB.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TEM8/ANTXR1
Antibody (200C1339(SB
NB100-56585
Immunohistochemistry-Paraffin: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Human colon stained with TEM8 antibody at 2.5 ug/ml concentration using DAB chromogen detection method (10X magnification)
Immunohistochemistry-Paraffin: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Detection of TEM8/ANTXR1 in human liver cancer section using 5 ug/ml concentration of TEM8 antibody. Uniform weak staining was observed in the cancerous cells, while the blood vessels depicted the expected intense positivity for TEM8.
Western Blot: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Analysis of human heart lysates (35ug per lane, RIPA buffer) using TEM8 antibody (NB100-56585) at 0.3ug/ml. Band observed at 65kDa. (Expected MW of 62.8kDa according to NP_115584.1).
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: WB
EVI-1 Antibody
NBP2-48848
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PDGF R beta
Antibody [Unconjugate
AF1042
PDGF R beta was detected in immersion fixed frozen sections of mouse embryo spinal cord using 5 µg/mL Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of rat spinal cord tissue, rat brain tissue, and mouse brain tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDGF R beta at approximately 190 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(35 Publications)
Species: Mu
Applications: IHC, WB
RUNX1T1/ETO
Antibody
NBP2-55747
Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, WB

Publications for ETV6/Tel Antibody (NBP1-80695)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ETV6/Tel Antibody (NBP1-80695) (0)

There are no reviews for ETV6/Tel Antibody (NBP1-80695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ETV6/Tel Antibody (NBP1-80695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Human Appendix Whole Tissue Lysate (Adult Whole Liver Cirrhosis)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ETV6/Tel Products

Bioinformatics Tool for ETV6/Tel Antibody (NBP1-80695)

Discover related pathways, diseases and genes to ETV6/Tel Antibody (NBP1-80695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV6/Tel Antibody (NBP1-80695)

Discover more about diseases related to ETV6/Tel Antibody (NBP1-80695).
 

Pathways for ETV6/Tel Antibody (NBP1-80695)

View related products by pathway.

PTMs for ETV6/Tel Antibody (NBP1-80695)

Learn more about PTMs related to ETV6/Tel Antibody (NBP1-80695).

Blogs on ETV6/Tel

There are no specific blogs for ETV6/Tel, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV6/Tel Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ETV6
Entrez
Uniprot