Immunocytochemistry/ Immunofluorescence: HLX1 Antibody [NBP1-89719] - Staining of human cell line HEK 293 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HLX1 Antibody [NBP1-89719] - Staining of human tonsil shows strong nuclear positivity in reaction center cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: CSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLPAAYHHHHPQQQQQQQ
Specificity
Specificity of human HLX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB reported in the literature (PMID: 29581848).
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%). Human reactivity reported in scientific literature (PMID: 23455154).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for HLX1 Antibody
H2.0 (Drosophila)-like homeo box 1
H2.0-like homeo box 1
H2.0-like homeo box-1
H2.0-like homeobox 1
H2.0-like homeobox protein
H2.0-like homeobox
HB24
HLX1H2.0-like homeobox 1 (Drosophila)
Homeobox protein HB24
Homeobox protein HLX1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for HLX1 Antibody (NBP1-89719)
Discover related pathways, diseases and genes to HLX1 Antibody (NBP1-89719). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HLX1 Antibody (NBP1-89719)
Discover more about diseases related to HLX1 Antibody (NBP1-89719).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HLX1 Antibody and receive a gift card or discount.
PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation
Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally.
![Immunocytochemistry/Immunofluorescence: HLX1 Antibody [NBP1-89719] - Staining of human cell line HEK 293 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/HLX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89719-img0006.jpg "Immunocytochemistry/Immunofluorescence: HLX1 Antibody [NBP1-89719] - Staining of human cell line HEK 293 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: HLX1 Antibody [NBP1-89719] - Staining of human tonsil shows strong nuclear positivity in reaction center cells.](http://images.novusbio.com/fullsize2/HLX1-Antibody-Immunohistochemistry-Paraffin-NBP1-89719-img0002.jpg "Immunohistochemistry-Paraffin: HLX1 Antibody [NBP1-89719] - Staining of human tonsil shows strong nuclear positivity in reaction center cells.")
![Western Blot: T-bet/TBX21 Antibody (39D) [NBP1-43299] - CD4+ T cells were sorted from mouse splenocytes, then activated with Anti-Mouse CD3 and Anti-Mouse CD28, followed by culture in Th1-polarizing conditions, and re-stimulation with PMA and Ionomycin. Lysates from control (left) or PMA and Ionomycin-re-stimulated (right) cells were probed with Anti-T-bet Purified at 2 ug/ml, and revealed with Anti-Mouse IgG HRP.](http://images.novusbio.com/images2/T-bet-TBX21-Antibody-(39D)-Western-Blot-NBP1-43299-img0004.jpg)
![Western Blot: BP1 Antibody [NB100-481] - Detection of MDA-MB-231 cell lysates.](http://images.novusbio.com/images2/BP1-Antibody-Western-Blot-NB100-481-img0004.jpg)
![Immunohistochemistry-Frozen: BP1 Antibody [NB100-481] - Top Panel: BP1 antibody detected in breast cancer cells. Bottom Panel: Staining of normal breast tissue.](http://images.novusbio.com/images2/BP1-Antibody-Immunohistochemistry-Frozen-NB100-481-img0005.jpg)
![Western Blot: BP1 Antibody [NB100-481] - Effect of BP1 on TNFalpha-induced cell death. Western blot analysis of Beta Protein 1 (BP1) protein expression in MCF7/EV cell lines and MCF7/BP1 cell lines. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr1766), licensed under a CC-BY licence.](http://images.novusbio.com/images2/BP1 Antibody-Western Blot-NB100-481-img0007.jpg)
![Western Blot: MNX1/HLXB9 Antibody [NBP2-24691] - Analysis of MNX1/HLXB9 in MOLT-4 cell lysates in the 1) absence and 2) presence of immunizing peptide using this antibody at 5 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/MNX1-HLXB9 Antibody-Western Blot-NBP2-24691-img0002.jpg)
![Immunohistochemistry-Paraffin: MNX1/HLXB9 Antibody [NBP2-24691] - Analysis of MNX1/HLXB9 in FFPE mouse pancreas tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.](http://images.novusbio.com/images2/MNX1-HLXB9 Antibody-Immunohistochemistry-Paraffin-NBP2-24691-img0001.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/images2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0015.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human urinary bladder shows weak nuclear positivity in urothelial cells.](http://images.novusbio.com/images2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0012.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/images2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0013.jpg)
![Western Blot: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of MEOX2 expression in transfected 293T cell line by MEOX2 monoclonal antibody (M03), clone 6A5. Lane 1: MEOX2 transfected lysatE (33 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/MEOX-2-Antibody-(6A5)-Western-Blot-H00004223-M03-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of monoclonal antibody to MEOX2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/MEOX-2-Antibody-(6A5)-Immunocytochemistry-Immunofluorescence-H00004223-M03-img0010.jpg)
![Immunohistochemistry-Paraffin: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of monoclonal antibody to MEOX2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1 ug/ml](http://images.novusbio.com/images2/MEOX-2-Antibody-(6A5)-Immunohistochemistry-Paraffin-H00004223-M03-img0011.jpg)
![Immunohistochemistry: CD4 Antibody [NBP1-19371] - Increased CD3+ and CD4+ T-cell occurrence in the brainstem of SHR-72 transgenic rat model for tauopathies. (A-D) Immunofluorescence staining showed CD4+ T-cells in SHR-72 transgenic animals. (E- H) Immunofluorescence staining showed more perivascular than brain parenchyma infiltrating CD4+ T-cells in SHR-72 transgenic animals. PLoS One. 2019 May 23;14(5):e0217216. doi: 10.1371/journal.pone.0217216.](http://images.novusbio.com/images2/CD4-Antibody-Immunohistochemistry-NBP1-19371-img0017.jpg)
![Immunohistochemistry: CD4 Antibody [NBP1-19371] - DBZ inhibits the accumulation of CD4+ T cells and Th2 differentiation in the AAAs. (B) The representation of immunohistochemical staining for CD4+ in abdominal aorta from four groups (left). Bar graphs show the percentage of CD4+ positive cell areas (right; n=3 per group). Bar: 50 um.](http://images.novusbio.com/images2/CD4-Antibody-Immunohistochemistry-NBP1-19371-img0018.jpg)
![Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.](http://images.novusbio.com/images2/CD4-Antibody-Western-Blot-NBP1-19371-img0002.jpg)
![IL-4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-4 [Unconjugated]")
![Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/CD34 Antibody (MEC 14.7)-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
![Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.](http://images.novusbio.com/images2/CD34-Antibody-(MEC-14.7)-Immunohistochemistry-Paraffin-NB600-1071-img0014.jpg)
![Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).](http://images.novusbio.com/images2/CD34-Antibody-(MEC-14.7)-Flow-Cytometry-NB600-1071-img0015.jpg)
![Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/Tetraspanin-31 Antibody-Western Blot-NBP1-62311-img0003.jpg)
![Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Expressed in E. coli, concentration 1 ug/ml.](http://images.novusbio.com/images2/Tetraspanin-31 Antibody-Western Blot-NBP1-62311-img0002.jpg)
![Western Blot: NANS Antibody [NBP1-87088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/images2/NANS-Antibody-Western-Blot-NBP1-87088-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: NANS Antibody [NBP1-87088] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/images2/NANS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87088-img0007.jpg)
![Immunohistochemistry-Paraffin: NANS Antibody [NBP1-87088] - Staining of human pancreas shows strong nuclear and weaker cytoplasmic positivity.](http://images.novusbio.com/images2/NANS-Antibody-Immunohistochemistry-Paraffin-NBP1-87088-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")