HLX1 Antibody - BSA Free

Staining of human cell line HEK 293 shows positivity in nucleus & cytoplasm.

Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.

Staining of human tonsil shows strong nuclear positivity in germinal center cells.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and HLX over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HLX1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLPAAYHHHHPQQQQQQQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB reported in the literature (PMID: 29581848).
• Control Peptide:

  HLX1 Protein (NBP1-89719PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%). Human reactivity reported in scientific literature (PMID: 23455154).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HLX1 Antibody - BSA Free

• H2.0 (Drosophila)-like homeo box 1
• H2.0-like homeo box 1
• H2.0-like homeo box-1
• H2.0-like homeobox 1
• H2.0-like homeobox protein
• H2.0-like homeobox
• HB24
• HLX1H2.0-like homeobox 1 (Drosophila)
• Homeobox protein HB24
• Homeobox protein HLX1

Background

Transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance ofTh1-specific gene expression. Involved in embryogenesis and hematopoiesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HLX1 Antibody (NBP1-89719)(3)

Publications using NBP1-89719

• Nagel S, Pommerenke C, MacLeod RAF et al. The NKL-code for innate lymphoid cells reveals deregulated expression of NKL homeobox genes HHEX and HLX in anaplastic large cell lymphoma (ALCL) Oncotarget 2020-08-25 [PMID: 32922661] (WB, Human)
• Nagel S, Pommerenke C, Meyer C et al. Aberrant expression of NKL homeobox gene HLX in Hodgkin lymphoma. Oncotarget. 2018-03-06 [PMID: 29581848] (WB, Human)
  
  Details:
  HLX1 antibody was used to look at HL cell line HLX expression using western blot
• Martin N, Popov N, Aguilo F et al. Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK4a regulation. EMBO J 2013-04-03 [PMID: 23455154] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: HLX