Home » HLX1 » HLX1 Antibodies » HLX1 Antibody

HLX1 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: HLX1 Antibody [NBP1-89719] - Staining of human cell line HEK 293 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: HLX1 Antibody [NBP1-89719] - Staining of human cell line HEK 293 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HLX1 Antibody [NBP1-89719] - Staining of human tonsil shows strong nuclear positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HLX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLPAAYHHHHPQQQQQQQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB reported in the literature (PMID: 29581848).
Control Peptide
HLX1 Protein (NBP1-89719PEP)
Publications
Read Publications using
NBP1-89719 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%). Human reactivity reported in scientific literature (PMID: 23455154).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLX1 Antibody

  • H2.0 (Drosophila)-like homeo box 1
  • H2.0-like homeo box 1
  • H2.0-like homeo box-1
  • H2.0-like homeobox 1
  • H2.0-like homeobox protein
  • H2.0-like homeobox
  • HB24
  • HLX1H2.0-like homeobox 1 (Drosophila)
  • Homeobox protein HB24
  • Homeobox protein HLX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

T-bet/TBX21
Antibody (39D) - BSA
NBP1-43299
Western Blot: T-bet/TBX21 Antibody (39D) [NBP1-43299] - CD4+ T cells were sorted from mouse splenocytes, then activated with Anti-Mouse CD3 and Anti-Mouse CD28, followed by culture in Th1-polarizing conditions, and re-stimulation with PMA and Ionomycin. Lysates from control (left) or PMA and Ionomycin-re-stimulated (right) cells were probed with Anti-T-bet Purified at 2 ug/ml, and revealed with Anti-Mouse IgG HRP.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
BP1 Antibody
NB100-481
Western Blot: BP1 Antibody [NB100-481] - Effect of BP1 on TNFalpha-induced cell death. Western blot analysis of Beta Protein 1 (BP1) protein expression in MCF7/EV cell lines and MCF7/BP1 cell lines. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr1766), licensed under a CC-BY licence.
Western Blot: BP1 Antibody [NB100-481] - Detection of MDA-MB-231 cell lysates.
Immunohistochemistry-Frozen: BP1 Antibody [NB100-481] - Top Panel: BP1 antibody detected in breast cancer cells. Bottom Panel: Staining of normal breast tissue.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, IP, WB
GATA-3 Antibody
[Unconjugated]
AF2605
Western blot shows lysates of MCF‑7 human breast cancer cell line, Jurkat human acute T cell leukemia cell line, and EL‑4 mouse lymphoblast cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). Specific bands were detected for GATA‑3 full length (FL) at approximately 55 kDa and the splice form (SF) at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
GATA‑3 was detected in immersion fixed MCF-7 human breast cancer cell line using 10 µg/mL Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for GATA‑3 full length (FL) at approximately 62 kDa and the splice form (SF) at approximately 52 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(16 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(24 Reviews)
(389 Publications)
Species: Hu
Applications: BA
MNX1/HLXB9 Antibody
NBP2-24691
Immunocytochemistry/Immunofluorescence: MNX1/HLXB9 Antibody [NBP2-24691] - MCF7 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MNX1/HLXB9 NBP2-24691 at 1 ug/ml for 60 minutes at room temperature and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: MNX1/HLXB9 Antibody [NBP2-24691] - Neuro2a cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MNX1/HLXB9 NBP2-24691 at 1 ug/ml for 60 minutes at room temperature and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: MNX1/HLXB9 Antibody [NBP2-24691] - Analysis of MNX1/HLXB9 in FFPE mouse pancreas tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MSX2 Antibody
NBP1-85445
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human urinary bladder shows weak nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human liver shows low positivity in hepatocytes as expected.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
MEOX 2 Antibody
(6A5)
H00004223-M03
Western Blot: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of MEOX2 expression in transfected 293T cell line by MEOX2 monoclonal antibody (M03), clone 6A5. Lane 1: MEOX2 transfected lysatE (33 KDa). Lane 2: Non-transfected lysate.
ELISA: MEOX 2 Antibody (6A5) [H00004223-M03] - Detection limit for recombinant GST tagged MEOX2 is approximately 0.3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of monoclonal antibody to MEOX2 on HeLa cell. Antibody concentration 10 ug/ml
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(39 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
HGF [Unconjugated]
294-HG/CF
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(97 Publications)
Species: Hu
Applications: BA
TGF-beta 2
302-B2/CF
1 μg/lane of Recombinant Human TGF-beta 2 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 12 kDa and 24 kDa, respectively.
Recombinant Human TGF-beta 2 (Catalog # 302-B2/CF) inhibits Recombinant Mouse IL‑4 (Catalog # 404-ML) induced cell proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.025-0.25 ng/mL.
(68 Publications)
Species: Hu
Applications: BA
GATA-3 Antibody
[Unconjugated]
AF2605
Western blot shows lysates of MCF‑7 human breast cancer cell line, Jurkat human acute T cell leukemia cell line, and EL‑4 mouse lymphoblast cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). Specific bands were detected for GATA‑3 full length (FL) at approximately 55 kDa and the splice form (SF) at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
GATA‑3 was detected in immersion fixed MCF-7 human breast cancer cell line using 10 µg/mL Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for GATA‑3 full length (FL) at approximately 62 kDa and the splice form (SF) at approximately 52 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(16 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.05-0.2 ng/mL.
(3 Publications)
Species: Hu
Applications: BA
CD34 Antibody (MEC
14.7)
NB600-1071
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(24 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(48 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
(10 Reviews)
(238 Publications)
Species: Mu
Applications: ELISA
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(338 Publications)
Species: Hu
Applications: BA
Tetraspanin-31
Antibody
NBP1-62311
Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Expressed in E. coli, concentration 1 ug/ml.
Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: IHC, IHC-P, WB
IL-5 [HRP]
M5000
(3 Reviews)
(79 Publications)
Species: Mu
Applications: ELISA
NANS Antibody
NBP3-06254
Western Blot: NANS Antibody [NBP3-06254] - Anti-NANS rabbit polyclonal antibody at 1:500 dilutionLane A: HepG2 Whole Cell LysateLane B: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane.Secondary: Goat Anti-Rabbit IgG (H+L) RP at 110000 dilution. eveloped using the ECL technique. erformed under reducing conditions. Pedicted band size:40 kDa Observed band size: 40 kDa
Immunocytochemistry/Immunofluorescence: NANS Antibody [NBP3-06254] - Immunofluorescence staining of NANS in U2OS cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS,blocked with 10% serum, and incubated with rabbit anti-Human NANS polyclonal antibody (dilution ratio 1:200) at 4 degrees celsius overnight. Then cells were stained with the Alexa Fluor (TM) 488-conjugated Goat Anti-rabbit IgG secondary antibody (green). Positive staining was localized to Nucleus.
Immunoprecipitation: NANS Antibody [NBP3-06254] - NANS was immunoprecipitated using:Lane A:0.5 mg U-251 MG Whole Cell Lysate 4 uL anti-NANS rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein AG. Primary antibody:Anti-NANS rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L) HRP at 110000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 40 kDa Observed band size :40 kDa
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for HLX1 Antibody (NBP1-89719)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(3)
All Applications
Filter By Species
Human
(3)
All Species

Reviews for HLX1 Antibody (NBP1-89719) (0)

There are no reviews for HLX1 Antibody (NBP1-89719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HLX1 Antibody (NBP1-89719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLX1 Products

Bioinformatics Tool for HLX1 Antibody (NBP1-89719)

Discover related pathways, diseases and genes to HLX1 Antibody (NBP1-89719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLX1 Antibody (NBP1-89719)

Discover more about diseases related to HLX1 Antibody (NBP1-89719).
 

Pathways for HLX1 Antibody (NBP1-89719)

View related products by pathway.

PTMs for HLX1 Antibody (NBP1-89719)

Learn more about PTMs related to HLX1 Antibody (NBP1-89719).

Blogs on HLX1

There are no specific blogs for HLX1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLX1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HLX