HLX1 Antibody

Images

 
Western Blot: HLX1 Antibody [NBP1-89719] - Analysis in control (vector only transfected HEK293T lysate) and HLX over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: HLX1 Antibody [NBP1-89719] - Staining of human cell line HEK 293 shows positivity in nucleus and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HLX1 Antibody [NBP1-89719] - Staining of human tonsil shows strong nuclear positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HLX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLPAAYHHHHPQQQQQQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HLX1 Protein (NBP1-89719PEP)
Publications
Read Publication using
NBP1-89719 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%). Human reactivity reported in scientific literature (PMID: 23455154).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLX1 Antibody

  • H2.0 (Drosophila)-like homeo box 1
  • H2.0-like homeo box 1
  • H2.0-like homeo box-1
  • H2.0-like homeobox 1
  • H2.0-like homeobox protein
  • H2.0-like homeobox
  • HB24
  • HLX1H2.0-like homeobox 1 (Drosophila)
  • Homeobox protein HB24
  • Homeobox protein HLX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-24691
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
302-B2/CF
Species: Hu
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HLX1 Antibody (NBP1-89719)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HLX1 Antibody (NBP1-89719) (0)

There are no reviews for HLX1 Antibody (NBP1-89719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HLX1 Antibody (NBP1-89719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLX1 Products

Bioinformatics Tool for HLX1 Antibody (NBP1-89719)

Discover related pathways, diseases and genes to HLX1 Antibody (NBP1-89719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLX1 Antibody (NBP1-89719)

Discover more about diseases related to HLX1 Antibody (NBP1-89719).
 

Pathways for HLX1 Antibody (NBP1-89719)

View related products by pathway.

PTMs for HLX1 Antibody (NBP1-89719)

Learn more about PTMs related to HLX1 Antibody (NBP1-89719).

Blogs on HLX1

There are no specific blogs for HLX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLX