MIF Antibody - BSA Free

Western Blot: MIF Antibody [NBP1-81832] - Analysis in human cell lines HEK293 and U-251MG using Anti-MIF antibody. Corresponding MIF RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1

Western Blot: MIF Antibody [NBP1-81832] - Expression and purification of MaMIF. Western blot analysis with isotype-matched primary antibody shows the background level of antibody binding to the protein. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-51947-7), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: MIF Antibody [NBP1-81832] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: MIF Antibody [NBP1-81832] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human kidney moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Western Blot: MIF Antibody [NBP1-81832] - Expression & purification of MaMIF. (A) SDS-PAGE analysis of purified MaMIF suggesting an approximate molecular mass of ~12.5 kDa for the monomer. (B) Superdex 75 10/300 GL analytical size-exclusion chromatography profile of MaMIF suggesting an apparent molecular mass of ~39 kDa in solution, corresponding to the size of a trimeric form. (C) CD spectrum of MaMIF confirming a properly folded protein. The pie chart in the inset shows the secondary structure make-up of the protein. (D) Western blot analysis with polyclonal anti-His & anti-MIF antibodies confirming the expressed protein to be MaMIF. (E) Western blot analysis with isotype-matched primary antibody shows the background level of antibody binding to the protein. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31664114), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt, Ha
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MIF Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MIF Protein (NBP1-81832PEP)

Reactivity Notes

Hamster reactivity reported in scientific literature (PMID: 31664114).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MIF Antibody - BSA Free

• EC 5.3.2.1
• EC 5.3.3.12
• GIFmacrophage migration inhibitory factor
• GLIF
• Glycosylation-inhibiting factor
• L-dopachrome isomerase
• L-dopachrome tautomerase
• macrophage migration inhibitory factor (glycosylation-inhibiting factor)
• MIF
• MMIF
• Phenylpyruvate tautomerase

Background

MIF encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MIF Antibody (NBP1-81832)(4)

Publications using NBP1-81832

• Suresh V, Dash P, Suklabaidya S et al. MIF confers survival advantage to pancreatic CAFs by suppressing interferon pathway-induced p53-dependent apoptosis FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2022-08-01 [PMID: 35839070]
• Suresh V, Sundaram R, Dash P et al. Macrophage migration inhibitory factor of Syrian golden hamster shares structural and functional similarity with human counterpart and promotes pancreatic cancer Sci Rep 2019-10-29 [PMID: 31664114] (WB, Hamster)
• Polajeva J, Bergstrom T, Edqvist PH et al. Glioma-derived macrophage migration inhibitory factor (MIF) promotes mast cell recruitment in a STAT5-dependent manner. Mol Oncol 2014-02-01 [PMID: 24091309]
• Ma Y, Visser L, Roelofsen H et al. Proteomics analysis of Hodgkin lymphoma: identification of new players involved in the cross-talk between HRS cells and infiltrating lymphocytes. Blood 2008-02-01 [PMID: 18070985]

Bioinformatics

• Gene Symbol: MIF