MIF Antibody

Images

 
Orthogonal Strategies: Western Blot: MIF Antibody [NBP1-81832] - Analysis in human cell lines HEK293 and U-251MG using Anti-MIF antibody. Corresponding MIF RNA-seq data are presented for the same cell lines. ...read more
Western Blot: MIF Antibody [NBP1-81832] - Expression and purification of MaMIF. Western blot analysis with isotype-matched primary antibody shows the background level of antibody binding to the protein. Image collected ...read more
Immunocytochemistry/ Immunofluorescence: MIF Antibody [NBP1-81832] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: MIF Antibody [NBP1-81832] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human kidney moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, HaSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MIF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIF Protein (NBP1-81832PEP)
Publications
Read Publications using
NBP1-81832 in the following applications:

  • WB
    2 publications

Reactivity Notes

Hamster reactivity reported in scientific literature (PMID: 31664114).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIF Antibody

  • EC 5.3.2.1
  • EC 5.3.3.12
  • GIFmacrophage migration inhibitory factor
  • GLIF
  • Glycosylation-inhibiting factor
  • L-dopachrome isomerase
  • L-dopachrome tautomerase
  • macrophage migration inhibitory factor (glycosylation-inhibiting factor)
  • MIF
  • MMIF
  • Phenylpyruvate tautomerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1985
Species: Hu, Mu(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
6507-IL/CF
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, PAGE, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-81832
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MIF Antibody (NBP1-81832)(4)

We have publications tested in 1 confirmed species: Hamster.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Hamster
(2)
All Species

Reviews for MIF Antibody (NBP1-81832) (0)

There are no reviews for MIF Antibody (NBP1-81832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MIF Antibody (NBP1-81832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MIF Products

Bioinformatics Tool for MIF Antibody (NBP1-81832)

Discover related pathways, diseases and genes to MIF Antibody (NBP1-81832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIF Antibody (NBP1-81832)

Discover more about diseases related to MIF Antibody (NBP1-81832).
 

Pathways for MIF Antibody (NBP1-81832)

View related products by pathway.

PTMs for MIF Antibody (NBP1-81832)

Learn more about PTMs related to MIF Antibody (NBP1-81832).

Blogs on MIF

There are no specific blogs for MIF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIF