MEF2D Antibody

Images

 
Western Blot: MEF2D Antibody [NBP1-85788] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: MEF2D Antibody [NBP1-85788] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human skeletal muscle shows high expression.
Western Blot: MEF2D Antibody [NBP1-85788] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining in human skeletal muscle and liver tissues using anti-MEF2D antibody. Corresponding MEF2D RNA-seq data are presented ...read more
ELISA: MEF2D Antibody [NBP1-85788] - Lysates from NIH3T3 and SVG-A cells assessed by ELISA, loading the indicated mass of total protein per well. Antibody was diluted 1:250, and used in conjunction with an ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MEF2D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTL
Specificity
Specificity of human, mouse, rat MEF2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEF2D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MEF2D Protein (NBP1-85788PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-85788 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEF2D Antibody

  • DKFZp686I1536
  • MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancerfactor 2D)
  • MEF2D/DAZAP1 fusion
  • myocyte enhancer factor 2D
  • myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusionprotein
  • myocyte-specific enhancer factor 2D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56341
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-93440
Species: Hu
Applications: IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP

Publications for MEF2D Antibody (NBP1-85788) (0)

There are no publications for MEF2D Antibody (NBP1-85788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEF2D Antibody (NBP1-85788) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Human and Mouse.

Reviews using NBP1-85788:
Filter by Applications
ELISA
(1)
Simple Western
(1)
All Applications
Filter by Species
Mouse
(1)
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
ELISA MEF2D NBP1-85788
Enlarge
reviewed by:
Anonymous
ELISA Human and Mouse 06/05/2018
View

Summary

ApplicationELISA
Sample TestedSVG-A cells,NIH 3T3 cells
SpeciesHuman and Mouse
LotA10542D
Simple Western MEF2D NBP1-85788
Enlarge
reviewed by:
Anonymous
Simple Western Mouse 03/25/2016
View

Summary

ApplicationSimple Western
Sample Testedmouse whole brain lysate
SpeciesMouse

Blocking

Blocking Detailsn/a

Primary Anitbody

Dilution Ratio1:1000, 1:250, 1:50

Details

Detection NotesWes Simple Western platform

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEF2D Antibody (NBP1-85788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MEF2D Antibody (NBP1-85788)

Discover related pathways, diseases and genes to MEF2D Antibody (NBP1-85788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEF2D Antibody (NBP1-85788)

Discover more about diseases related to MEF2D Antibody (NBP1-85788).
 

Pathways for MEF2D Antibody (NBP1-85788)

View related products by pathway.

PTMs for MEF2D Antibody (NBP1-85788)

Learn more about PTMs related to MEF2D Antibody (NBP1-85788).

Blogs on MEF2D

There are no specific blogs for MEF2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Anonymous
06/05/2018
Application: ELISA
Species: Human and Mouse

Anonymous
03/25/2016
Application: Simple Western
Species: Mouse

Bioinformatics

Gene Symbol MEF2D