LIF Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LIF Antibody [NBP1-85717] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LIF Antibody [NBP1-85717] - Staining of human endometrium shows strong positivity in cilia.

Immunohistochemistry-Paraffin: LIF Antibody [NBP1-85717] - Staining of human cerebral cortex shows moderate positivity.

Immunohistochemistry-Paraffin: LIF Antibody [NBP1-85717] - Staining of human lung shows strong cytoplasmic positivity.

Immunohistochemistry-Paraffin: LIF Antibody [NBP1-85717] - Staining of human prostate cancer shows moderate cytoplasmic positivity.

Immunohistochemistry-Paraffin: LIF Antibody [NBP1-85717] - Staining of human urinary bladder shows moderate cytoplasmic positivity.

Analysis in human cell lines U-251MG and HEK293 using Anti-LIF antibody. Corresponding LIF RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LIF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LIF Antibody - BSA Free (NBP1-85717) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-LIF Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEK
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LIF Protein (NBP1-85717PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LIF Antibody - BSA Free

• CDF
• D Factor
• DIA
• differentiation inhibitory activity
• differentiation stimulating factor
• Differentiation-stimulating factor
• Emfilermin
• HILDA
• HILDAcholinergic differentiation factor
• leukemia inhibitory factor (cholinergic differentiation factor)
• leukemia inhibitory factor
• LIF
• Melanoma-derived LPL inhibitor
• MLPLI

Background

LIF (leukemia inhibitory factor, myeloid leukemia inhibitory factor) a pleiotropic lymphoid factor was initially described as a factor that inhibits the proliferation of myeloid leukemia cells and induces their differentiation into macrophages. Other activities of LIF include inhibition of adipogenesis, cholinergic neuron differentiation and bone metabolism. Human and mouse LIF share 78% homology and activities of LIF are not species-specific. Human LIF is active on mouse cells, but murine LIF is not active on human cells. Benefits of NovActive® Proteins

Fully Active

-Fully folded naturally by eukaryotic source

-Comparable for eukaryotic glycosylation

BioRisk Free

-animal-free

-serum-free

-endotoxin-free

-infection reagent-free

-low in proteolyic activity

-low in pyrogenic and pro-inflammatory activity

Just reconstitute and add to your cell culture.

Have FDA G.R.A.S. (generally recognized as safe) approval.

Advantages of barley endosperm Folding -Proficient protein machinery, with eukaryotic folding, allows for native formation of the protein and long term protection and storage. Environment -A biochemically inert environment, void of endotoxins, low protease activity and secondary metabolite content, and a simple protein profile, aid in downstream processing in barley. FDA G.R.A.S status -Barley is recognized by the FDA as having G.R.A.S (generally recognized as safe) status.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LIF Antibody (NBP1-85717)(1)

Publication using NBP1-85717

• Koo H, Yoon M, Hong S et al. Non-invasive intra-uterine administration of Botulinum Toxin A enhances endometrial angiogenesis and improves the rates of embryo implantation Reprod Sci 2021-03-02 [PMID: 33650094]

Bioinformatics

• Gene Symbol: LIF