LRPPRC Antibody

Images

 
Western Blot: LRPPRC Antibody [NBP1-83349] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: LRPPRC Antibody [NBP1-83349] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human cerebellum shows strong granular cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRPPRC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRPPRC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRPPRC Protein (NBP1-83349PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRPPRC Antibody

  • CLONE-23970
  • leucine-rich PPR-motif containing
  • mitochondrial leucine-rich PPR motif-containing protein
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
557-NT/CF
Species: Rt
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2988
Species: Mu, Rt
Applications: WB
NBP1-83349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRPPRC Antibody (NBP1-83349) (0)

There are no publications for LRPPRC Antibody (NBP1-83349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRPPRC Antibody (NBP1-83349) (0)

There are no reviews for LRPPRC Antibody (NBP1-83349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRPPRC Antibody (NBP1-83349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRPPRC Products

Bioinformatics Tool for LRPPRC Antibody (NBP1-83349)

Discover related pathways, diseases and genes to LRPPRC Antibody (NBP1-83349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRPPRC Antibody (NBP1-83349)

Discover more about diseases related to LRPPRC Antibody (NBP1-83349).
 

Pathways for LRPPRC Antibody (NBP1-83349)

View related products by pathway.

PTMs for LRPPRC Antibody (NBP1-83349)

Learn more about PTMs related to LRPPRC Antibody (NBP1-83349).

Blogs on LRPPRC

There are no specific blogs for LRPPRC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRPPRC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRPPRC