LGSN Antibody - BSA Free

Immunohistochemistry-Paraffin: LGSN Antibody [NBP1-93715] - Staining of human testis.

Immunohistochemistry-Paraffin: LGSN Antibody [NBP1-93715] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: LGSN Antibody [NBP1-93715] - Staining of human eye shows moderate positivity in the lens.

Immunohistochemistry-Paraffin: LGSN Antibody [NBP1-93715] - Staining of human eye, liver, lymph node and testis using Anti-LGSN antibody NBP1-93715 (A) shows similar protein distribution across tissues to independent antibody NBP2-58511 (B).

Immunohistochemistry-Paraffin: LGSN Antibody [NBP1-93715] - Staining of human liver.

Immunohistochemistry-Paraffin: LGSN Antibody [NBP1-93715] - Staining of human lymph node.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LGSN Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LGSN Antibody - BSA Free (NBP1-93715) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGSN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LGSN Protein (NBP1-93715PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LGSN Antibody - BSA Free

• GLULD1
• glutamate-ammonia ligase (glutamine synthase) domain containing 1
• glutamate-ammonia ligase (glutamine synthetase) domain containing 1
• Glutamate-ammonia ligase domain-containing protein 1
• lengsin
• lengsin, lens protein with glutamine synthetase domain
• Lens glutamine synthase-like
• LGSMGC163240
• MGC163238

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LGSN