SMAP1 Antibody

Western Blot: SMAP1 Antibody [NBP1-83702] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SMAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SMAP1 Antibody [NBP1-83702] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SMAP1 Antibody [NBP1-83702] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Western Blot: SMAP1 Antibody [NBP1-83702] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMAP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSIL
• Localization: Cytoplasm. Nucleus. Predominant in the perinuclear region. Little Protein in the nucleus.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 103 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SMAP1 Protein (NBP1-83702PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23752192)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMAP1 Antibody

• FLJ13159
• FLJ42245
• small ArfGAP 1
• SMAP-1
• stromal membrane-associated GTPase-activating protein 1
• stromal membrane-associated protein 1

Background

SMAP1 is encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMAP1 Antibody (NBP1-83702)(1)

Publication using NBP1-83702

• Sangar F, Schreurs AS, Umana-Diaz C et al. Involvement of small ArfGAP1 (SMAP1), a novel Arf6-specific GTPase-activating protein, in microsatellite instability oncogenesis. Oncogene 2014-05-22 [PMID: 23752192]

Bioinformatics

• Gene Symbol: SMAP1
• Entrez:
  • 60682(Human)
• Uniprot:
  • Q9H3U1(Human)