Bcl-9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Bcl-9 Antibody [NBP2-30472] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry: Bcl-9 Antibody [NBP2-30472] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Bcl-9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGPGPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQVVVQQCSLQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Bcl-9 Protein (NBP2-30472PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Bcl-9 Antibody

  • B-cell CLL/lymphoma 9 protein
  • B-cell CLL/lymphoma 9
  • B-cell lymphoma 9 protein
  • Bcl9
  • Bcl-9
  • BCL9L
  • LGS
  • MGC131591
  • Protein legless homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF1620
Species: Mu
Applications: WB, IHC
MAB3617
Species: Hu, Mu
Applications: WB
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Bcl-9 Antibody (NBP2-30472) (0)

There are no publications for Bcl-9 Antibody (NBP2-30472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl-9 Antibody (NBP2-30472) (0)

There are no reviews for Bcl-9 Antibody (NBP2-30472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Bcl-9 Antibody (NBP2-30472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bcl-9 Products

Bioinformatics Tool for Bcl-9 Antibody (NBP2-30472)

Discover related pathways, diseases and genes to Bcl-9 Antibody (NBP2-30472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl-9 Antibody (NBP2-30472)

Discover more about diseases related to Bcl-9 Antibody (NBP2-30472).
 

Pathways for Bcl-9 Antibody (NBP2-30472)

View related products by pathway.

PTMs for Bcl-9 Antibody (NBP2-30472)

Learn more about PTMs related to Bcl-9 Antibody (NBP2-30472).
 

Research Areas for Bcl-9 Antibody (NBP2-30472)

Find related products by research area.

Blogs on Bcl-9

There are no specific blogs for Bcl-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bcl-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL9
Entrez
Uniprot