![Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize2/Exostosin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91875-img0009.jpg "Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCL |
| Predicted Species | Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EXT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NBP1-54467-img0012.jpg)
-Western-Blot-NBP1-54467-img0001.jpg)
-Immunohistochemistry-NBP1-54467-img0011.jpg)
| Publication using NBP1-91875 | Applications | Species |
|---|---|---|
| Coulson-Thomas VJ, Gesteira TF, Esko J et al. Heparan Sulfate Regulates Hair Follicle and Sebaceous Gland Morphogenesis and Homeostasis. J Biol Chem 2014-09-05 [PMID: 25053416] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for Exostosin 1 Antibody (NBP1-91875)Discover more about diseases related to Exostosin 1 Antibody (NBP1-91875).
| Pathways for Exostosin 1 Antibody (NBP1-91875)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EXT1 |
![Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Exostosin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91875-img0006.jpg "Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/Exostosin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91875-img0007.jpg "Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human placenta shows moderate ctyoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/Exostosin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91875-img0008.jpg "Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human placenta shows moderate ctyoplasmic positivity in trophoblastic cells.")
![Western Blot Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Western_Blot_11618.jpg)
![Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Immunohistochemistry_11640.jpg)
![Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Flow_Cytometry_11674.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Western Blot TRPS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/TRPS1_AF4838_Western_Blot_5562.jpg)
![Simple Western TRPS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/TRPS1_AF4838_Simple_Western_17010.jpg)
-Western-Blot-H00003077-M01-img0009.jpg)
-Immunocytochemistry-Immunofluorescence-H00003077-M01-img0006.jpg)
-Western-Blot-H00003077-M01-img0008.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")