Exostosin 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human placenta shows moderate ctyoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Exostosin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCL
Specificity
Specificity of human Exostosin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using
NBP1-91875 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25053416).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Exostosin 1 Antibody

  • EC 2.4.1.224
  • EC 2.4.1.225
  • exostoses (multiple) 1
  • Exostosin 1
  • exostosin-1
  • EXT
  • EXT1
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase
  • Langer-Giedion syndrome chromosome region
  • LGCR
  • LGS
  • Multiple exostoses protein 1
  • N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
  • Putative tumor suppressor protein EXT1
  • TRPS2
  • TTV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58297
Species: Hu
Applications: WB, IHC
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
NBP2-67344
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-16394
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44448
Species: Hu, Mu, Po, Fi, Mk
Applications: Flow, IHC, IHC-P, IF
AF4838
Species: Hu
Applications: WB, Simple Western
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1329
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-57016
Species: Hu
Applications: WB
MAB4214
Species: Mu
Applications: WB, IP

Publications for Exostosin 1 Antibody (NBP1-91875)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Exostosin 1 Antibody (NBP1-91875) (0)

There are no reviews for Exostosin 1 Antibody (NBP1-91875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Exostosin 1 Antibody (NBP1-91875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Exostosin 1 Products

Bioinformatics Tool for Exostosin 1 Antibody (NBP1-91875)

Discover related pathways, diseases and genes to Exostosin 1 Antibody (NBP1-91875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exostosin 1 Antibody (NBP1-91875)

Discover more about diseases related to Exostosin 1 Antibody (NBP1-91875).
 

Pathways for Exostosin 1 Antibody (NBP1-91875)

View related products by pathway.

PTMs for Exostosin 1 Antibody (NBP1-91875)

Learn more about PTMs related to Exostosin 1 Antibody (NBP1-91875).
 

Research Areas for Exostosin 1 Antibody (NBP1-91875)

Find related products by research area.

Blogs on Exostosin 1

There are no specific blogs for Exostosin 1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exostosin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXT1
COVID-19 update