LEDGF Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LEDGF Antibody [NBP1-87885] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Staining of human kidney shows strong nuclear positivity in cells in tubules.

Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.

Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Staining of human prostate shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-PSIP1 (NBP1-87885) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LEDGF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LEDGF Antibody - BSA Free (NBP1-87885) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LEDGF Protein (NBP1-87885PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LEDGF Antibody - BSA Free

• CLL-associated antigen KW-7
• Dense fine speckles 70 kDa protein
• DFS 70
• DFS70
• LEDGF
• LEDGFDFS 70
• Lens epithelium-derived growth factor
• MGC74712
• p52
• p75
• PAIP
• PC4 and SFRS1 interacting protein 1
• PC4 and SFRS1 interacting protein 2
• PC4 and SFRS1-interacting protein
• PSIP1
• PSIP2
• transcriptional coactivator p52/p75
• Transcriptional coactivator p75/p52

Background

The human p75 protein is a non TAF transcription coactivator that mediates activator dependent transcription by RNA polymerase II in vitro through most tested activators. Although p75 and p52 are derived from alternatively splicing of a single gene and share most coding sequence, they reveal different function in several aspects. In addition to functioning as a transcription coactivator, p75 has been reported to be involved in regulating growth of epithelial cells, pathogenesis of atopic dermatitis and activity of HIV1 integrase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSIP1