LEDGF Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LEDGF Antibody [NBP1-87885] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: LEDGF Antibody [NBP1-87885] - Staining of human cerebral cortex shows strong nuclear as well as cytoplasmic positivity in neuronal and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LEDGF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LEDGF Protein (NBP1-87885PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LEDGF Antibody

  • CLL-associated antigen KW-7
  • Dense fine speckles 70 kDa protein
  • DFS 70
  • DFS70
  • LEDGF
  • LEDGFDFS 70
  • Lens epithelium-derived growth factor
  • MGC74712
  • p52
  • p75
  • PAIP
  • PC4 and SFRS1 interacting protein 1
  • PC4 and SFRS1 interacting protein 2
  • PC4 and SFRS1-interacting protein
  • PSIP1
  • PSIP2
  • transcriptional coactivator p52/p75
  • Transcriptional coactivator p75/p52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87885
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LEDGF Antibody (NBP1-87885) (0)

There are no publications for LEDGF Antibody (NBP1-87885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEDGF Antibody (NBP1-87885) (0)

There are no reviews for LEDGF Antibody (NBP1-87885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LEDGF Antibody (NBP1-87885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LEDGF Products

Bioinformatics Tool for LEDGF Antibody (NBP1-87885)

Discover related pathways, diseases and genes to LEDGF Antibody (NBP1-87885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEDGF Antibody (NBP1-87885)

Discover more about diseases related to LEDGF Antibody (NBP1-87885).
 

Pathways for LEDGF Antibody (NBP1-87885)

View related products by pathway.

PTMs for LEDGF Antibody (NBP1-87885)

Learn more about PTMs related to LEDGF Antibody (NBP1-87885).
 

Research Areas for LEDGF Antibody (NBP1-87885)

Find related products by research area.

Blogs on LEDGF

There are no specific blogs for LEDGF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEDGF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSIP1
Entrez