PSMD12 Antibody

Images

 
Western Blot: PSMD12 Antibody [NBP1-87801] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: PSMD12 Antibody [NBP1-87801] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules.
Immunohistochemistry-Paraffin: PSMD12 Antibody [NBP1-87801] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PSMD12 Antibody [NBP1-87801] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PSMD12 Antibody [NBP1-87801] - Staining of human salivary gland shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PSMD12 Antibody [NBP1-87801] - Staining in human testis and salivary gland tissues using anti-PSMD12 antibody. Corresponding PSMD12 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PSMD12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH
Specificity
Specificity of human PSMD12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMD12 Protein (NBP1-87801PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMD12 Antibody

  • 26S proteasome non-ATPase regulatory subunit 12
  • 26S proteasome regulatory subunit p55
  • 26S proteasome regulatory subunit RPN5
  • MGC75406
  • p55
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
  • Rpn5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PSMD12 Antibody (NBP1-87801) (0)

There are no publications for PSMD12 Antibody (NBP1-87801).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD12 Antibody (NBP1-87801) (0)

There are no reviews for PSMD12 Antibody (NBP1-87801). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD12 Antibody (NBP1-87801) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PSMD12 Products

Bioinformatics Tool for PSMD12 Antibody (NBP1-87801)

Discover related pathways, diseases and genes to PSMD12 Antibody (NBP1-87801). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD12 Antibody (NBP1-87801)

Discover more about diseases related to PSMD12 Antibody (NBP1-87801).
 

Pathways for PSMD12 Antibody (NBP1-87801)

View related products by pathway.

Blogs on PSMD12

There are no specific blogs for PSMD12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD12