Lactate Dehydrogenase B Antibody - BSA Free

Western Blot: Lactate Dehydrogenase B Antibody [NBP3-03453] - Analysis of extracts of various cell lines, using Lactate Dehydrogenase B antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunohistochemistry: Lactate Dehydrogenase B Antibody - BSA Free [Lactate Dehydrogenase B] - Immunohistochemistry analysis of Lactate Dehydrogenase B in paraffin-embedded Human colon tissue using Lactate Dehydrogenase B Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry: Lactate Dehydrogenase B Antibody - BSA Free [Lactate Dehydrogenase B] - Immunohistochemistry analysis of Lactate Dehydrogenase B in paraffin-embedded Mouse heart tissue using Lactate Dehydrogenase B Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry: Lactate Dehydrogenase B Antibody - BSA Free [Lactate Dehydrogenase B] - Immunohistochemistry analysis of Lactate Dehydrogenase B in paraffin-embedded Rat heart tissue using Lactate Dehydrogenase B Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase B Antibody - BSA Free [Lactate Dehydrogenase B] - Immunofluorescence analysis of Rat heart tissue using Lactate Dehydrogenase B Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lactate Dehydrogenase B Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human Lactate Dehydrogenase B (NP_002291.1). MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LDHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lactate Dehydrogenase B Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.27
• Epididymis Secretory Protein Li 281
• HEL-S-281
• Lactate Dehydrogenase B
• LDH heart subunit
• LDHB
• LDH-B
• LDHBD
• LDH-H
• L-lactate dehydrogenase B chain
• Renal Carcinoma Antigen NY-REN-46
• TRG-5

Background

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa). Lactate dehydrogenase B (LDH-B, heart subunit, LDH-H) is involved in the conversion of L-lactate and NAD to pryruvate and NADH and it is predominantly localized in the heart tissue. Similar to other LDH subunit, LDH-B is considered to be an important marker for germ cell tumor (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LDHB