Isocitrate Dehydrogenase 1/IDH1 Antibody


Genetic Strategies: Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining in human prostate and skeletal muscle tissues using anti-IDH1 antibody. Corresponding IDH1 more
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in human cell line RT-4.
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD

Order Details

Isocitrate Dehydrogenase 1/IDH1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Specificity of human, mouse, rat Isocitrate Dehydrogenase 1/IDH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Isocitrate Dehydrogenase 1/IDH1 Lysate (NBP2-64819)
Control Peptide
Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP)
Read Publication using NBP1-87428.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22125622)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Isocitrate Dehydrogenase 1/IDH1 Antibody

  • Cytosolic NADP-isocitrate dehydrogenase
  • EC
  • IDCD
  • IDH
  • IDH1
  • IDP
  • IDPC
  • isocitrate dehydrogenase [NADP] cytoplasmic
  • isocitrate dehydrogenase 1 (NADP+), soluble
  • Isocitrate Dehydrogenase 1
  • NADP(+)-specific ICDH
  • NADP-dependent isocitrate dehydrogenase, cytosolic
  • NADP-dependent isocitrate dehydrogenase, peroxisomal
  • Oxalosuccinate decarboxylase
  • PICD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)(1)

Reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428) (0)

There are no reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Bioinformatics Tool for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Discover related pathways, diseases and genes to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Discover more about diseases related to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428).

Pathways for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

View related products by pathway.

PTMs for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Learn more about PTMs related to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428).

Research Areas for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Find related products by research area.

Blogs on Isocitrate Dehydrogenase 1/IDH1

There are no specific blogs for Isocitrate Dehydrogenase 1/IDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Isocitrate Dehydrogenase 1/IDH1 Antibody and receive a gift card or discount.


Gene Symbol IDH1