Isocitrate Dehydrogenase 1/IDH1 Antibody

Images

 
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity ...read more
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in human cell line RT-4.
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

Isocitrate Dehydrogenase 1/IDH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP)
Publications
Read Publication using NBP1-87428.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22125622)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Isocitrate Dehydrogenase 1/IDH1 Antibody

  • Cytosolic NADP-isocitrate dehydrogenase
  • EC 1.1.1.42
  • IDCD
  • IDH
  • IDH1
  • IDP
  • IDPC
  • isocitrate dehydrogenase [NADP] cytoplasmic
  • isocitrate dehydrogenase 1 (NADP+), soluble
  • Isocitrate Dehydrogenase 1
  • NADP(+)-specific ICDH
  • NADP-dependent isocitrate dehydrogenase, cytosolic
  • NADP-dependent isocitrate dehydrogenase, peroxisomal
  • Oxalosuccinate decarboxylase
  • PICD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-32104
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-87428
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)(1)

Reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428) (0)

There are no reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Bioinformatics Tool for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Discover related pathways, diseases and genes to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Discover more about diseases related to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428).
 

Pathways for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

View related products by pathway.

PTMs for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Learn more about PTMs related to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428).
 

Research Areas for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)

Find related products by research area.

Blogs on Isocitrate Dehydrogenase 1/IDH1

There are no specific blogs for Isocitrate Dehydrogenase 1/IDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Isocitrate Dehydrogenase 1/IDH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDH1
Entrez