Home » ASXL1 » ASXL1 Antibodies » ASXL1 Antibody (6E2)

ASXL1 Antibody (6E2)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).
ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
6E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASXL1 Antibody (6E2) Summary

Immunogen
ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASXL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
This antibody is useful for ELISA, Western Blot. Use in immunoprecipitation reported in scientific literature (PMID: 24894717).
Control
ASXL1 Knockout HeLa Cell Lysate
Publications
Read Publications using
H00171023-M05 in the following applications:

  • IP
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASXL1 Antibody (6E2)

  • additional sex combs like 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Erythropoietin/EPO
[HRP]
MEP00B
(3 Reviews)
(77 Publications)
Species: Mu
FANCB Antibody
(M38P3E10)
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(19 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
G-CSF [HRP]
MCS00
(6 Reviews)
(41 Publications)
Species: Mu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(30 Reviews)
(643 Publications)
Species: Hu
G-CSF [HRP]
MCS00
(6 Reviews)
(41 Publications)
Species: Mu
RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MID1 Antibody
NBP1-26612
Western Blot: MID1 Antibody [NBP1-26612] - Whole cell lysate from HeLa (5, 15 and 50 ug) and 293T (T; 50 ug) cells. Antibody used at 1 ug/ml.
(1 Publication)
Species: Hu
Applications: IP (-), WB
Jak2 Antibody
(53B7)
NBP2-59451
Western Blot: Jak2 Antibody (53B7) [NBP2-59451] - Human breast cancer MCF7 cells were treated with control (Con) or Adenosine (Ado) and the expression of JAK2 was detected. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cells line, stained with DAPI (Blue) and anti-human JAK2 antibody at 1:100 with goat anti-mouse IgG Alexa Fluor 488 conjugate (Green).
Flow Cytometry: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cell line, antibody at 2 - 5 ug per 10^6cells (red line). Secondary antibody: goat anti-mouse IgG Alexa Fluor 488 conjugate. Isotype control antibody: mouse IgG (black line).
(1 Review)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Arginyl tRNA
synthetase Antibody
NBP1-88032
Western Blot: Arginyl tRNA synthetase Antibody [NBP1-88032] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP1-88032] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Arginyl tRNA synthetase Antibody [NBP1-88032] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
GM-CSF
[Unconjugated]
7954-GM/CF
GM-CSF [Unconjugated]
(1 Publication)
Species: Hu
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
TET2 Antibody
NBP2-32104
Western Blot: TET2 Antibody [NBP2-32104] - Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells. Antibodies: Affinity purified rabbit anti-TET2 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: TET2 Antibody [NBP2-32104] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-TET2 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Western Blot: TET2 Antibody [NBP2-32104] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from 293T cells. Antibodies: Affinity purified rabbit anti-TET2 antibody NBP2-32104 used for IP at 6 ug/mg lysate. TET2 was also immunoprecipitated by rabbit anti-TET2 antibody BL16766. For blotting immunoprecipitated TET2, NBP2-32104 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Immunohistochemistry-Paraffin: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Formalin-fixed, paraffin-embedded human Tonsil stained with HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
Flow (Intracellular): NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on THP-1 cells with NOD2 (2D9) antibody NB100-524AF488 (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Flt-3/Flk-2/CD135
Antibody (7E8.2C8)
NBP2-42210
Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position.
Immunohistochemistry-Paraffin: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells while the tumor stroma was largely negative for the staining.
Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis
Species: Hu
Applications: WB, Flow, IHC, IHC-P
GM-CSF
[Unconjugated]
7954-GM/CF
GM-CSF [Unconjugated]
(1 Publication)
Species: Hu
IL-3 [Unconjugated]
203-IL
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog # 203-IL) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02-0.1 ng/mL.
(144 Publications)
Species: Hu

Publications for ASXL1 Antibody (H00171023-M05)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ASXL1 Antibody (H00171023-M05) (0)

There are no reviews for ASXL1 Antibody (H00171023-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASXL1 Antibody (H00171023-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

ASXL1 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ASXL1 Products

Bioinformatics Tool for ASXL1 Antibody (H00171023-M05)

Discover related pathways, diseases and genes to ASXL1 Antibody (H00171023-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASXL1 Antibody (H00171023-M05)

Discover more about diseases related to ASXL1 Antibody (H00171023-M05).
 

Pathways for ASXL1 Antibody (H00171023-M05)

View related products by pathway.

PTMs for ASXL1 Antibody (H00171023-M05)

Learn more about PTMs related to ASXL1 Antibody (H00171023-M05).

Blogs on ASXL1.

Check out the latest blog posts on ASXL1.
The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASXL1 Antibody (6E2) and receive a gift card or discount.


Bioinformatics

Gene Symbol ASXL1
Uniprot