ASXL1 Antibody (6E2)

Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Functional effects of CRISPR/Cas9-mediated ASXL1 mutation correction. Evaluation of ASXL1 protein expression by Western blotting. Left-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, the K562 leukemia cell line (carrying the Y591X heterozygous ASXL1 mutation), and KBM5 clones (labeled 1-5) with heterozygous precise correction of the ASXL1 mutation. Right-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, and KBM5 clones (labeled 1-5) with homozygous precise correction of the ASXL1 mutation. Beta-actin was used as loading control. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/6392) licensed under a CC-BY licence.

Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).

ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 6E2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

ASXL1 Antibody (6E2) Summary

• Immunogen: ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ASXL1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
  • Immunoprecipitation
• Application Notes: This antibody is useful for ELISA, Western Blot. Use in immunoprecipitation reported in scientific literature (PMID: 24894717).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASXL1 Antibody (6E2)

• additional sex combs like 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASXL1 Antibody (H00171023-M05)(3)

Publications using H00171023-M05

• Valletta S, Dolatshad H, Bartenstein M et al. ASXL1 mutation correction by CRISPR/Cas9 restores gene function in leukemia cells and increases survival in mouse xenografts. Oncotarget 2015 Dec 29 [PMID: 26623729] (WB)
• Ismail IH, Davidson R, Gagne JP et al. Germ-line Mutations in BAP1 Impair its Function in DNA Double-Strand break Repair. Cancer Res. 2014 Jun 03 [PMID: 24894717] (WB, IP, Human)
  
  Details:
  U2OS cells were transfected with control/ASXL1 shRNA for 48 h and the nuclear extracts were processed for WB using ASXL1 and BAP1 antibodies. In another set of experiment, U2OS cells were exposed or not to radiation (6 Gy) followed by recovery for 2 hr and the nuclear extracts were processed for immunoprecipitation using BAP1 or ASXL1 antibodies followed by WB of flow through (FT) and elute (El) and 20% of the input (Supplementary Figure 2 C and D).
• Davies C, Yip BH, Fernandez-Mercado M et al. Silencing of ASXL1 impairs the granulomonocytic lineage potential of human CD34(+) progenitor cells. Br J Haematol. 2013 Jan 08 [PMID: 23294243]

Bioinformatics

• Gene Symbol: ASXL1
• Uniprot:
  • AAH64984(Human)