SDHB Antibody

Images

 
Genetic Strategies: Western Blot: SDHB Antibody [NBP1-87069] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SDHB antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: SDHB Antibody [NBP1-87069] - Staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Staining of human liver shows moderate to strong granular cytoplasmic postivity in hepatocytes.
Western Blot: SDHB Antibody [NBP1-87069] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human duodenum shows moderate to strong granular cytoplasmic positivity in glandular cells.
Simple Western: SDHB Antibody [NBP1-87069] - Simple Western lane view shows a specific band for SDHB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: SDHB Antibody [NBP1-87069] - Electropherogram image(s) of corresponding Simple Western lane view. SDHB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

SDHB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Marker
Mitochondria Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in literature (PMID:25720320). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
SDHB Protein (NBP1-87069PEP)
Publications
Read Publications using
NBP1-87069 in the following applications:

  • 6 publications
  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22170724)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SDHB Antibody

  • EC 1.3.5.1
  • FLJ92337
  • IP
  • Iron-sulfur subunit of complex II
  • PGL4
  • SDH
  • SDH1
  • SDH2
  • SDHIP
  • succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  • succinate dehydrogenase complex, subunit B, iron sulfur (Ip)

Background

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87416
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81948
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00006391-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF482
Species: Mu
Applications: IHC, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92259
Species: Hu
Applications: IHC, IHC-P
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for SDHB Antibody (NBP1-87069)(16)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IF/IHC, WB.


Filter By Application
IF/IHC
(6)
WB
(2)
All Applications
Filter By Species
Human
(6)
Rat
(1)
All Species
Showing Publications 1 - 10 of 16. Show All 16 Publications.
Publications using NBP1-87069 Applications Species
Kang K, Ko J, Lee H et al. Surgically Metabolic Resection of Pericardial Fat to Ameliorate Myocardial Mitochondrial Dysfunction in the Acute Myocardial Infarction Obese Rat Journal of Korean Medical Science 2022-02-08 [PMID: 35257523] (WB, Rat) WB Rat
Thomas G Papathomas, Lindsey Oudijk, Alexandre Persu et al. SDHB/SDHA immunohistochemistry in pheochromocytomas and paragangliomas: a multicenter interobserver variation analysis using virtual microscopy: a Multinational Study of the European Network for the Study of Adrenal Tumors (ENS@T). Modern Pathology 2015-02-27 [PMID: 25720320] (IF/IHC, Human) IF/IHC Human
Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human) WB Human
Bayley JP, Oldenburg RA, Nuk J et al. Paraganglioma and pheochromocytoma upon maternal transmission of SDHD mutations. BMC Med Genet 2014-10-10 [PMID: 25300370] (IF/IHC, Human) IF/IHC Human
Nannini M, Astolfi A, Urbini M et al. Integrated genomic study of quadruple-WT GIST (KIT/PDGFRA/SDH/RAS pathway wild-type GIST). BMC Cancer 2014-09-20 [PMID: 25239601] (IF/IHC, Human) IF/IHC Human
Clarissa A Cassol, Daniel Winer, Wei Liu et al. Tyrosine kinase receptors as molecular targets in pheochromocytomas and paragangliomas. Modern Pathology 2014-01-01 [PMID: 24390213] (IF/IHC, Human) IF/IHC Human
Jamilloux Y, Favier J, Pertuit M et al. A MEN1 syndrome with a paraganglioma. Eur J Hum Genet 2014-02-01 [PMID: 23778871] (IF/IHC, Human) IF/IHC Human
Pantaleo MA, Astolfi A, Urbini M et al. Analysis of all subunits, SDHA, SDHB, SDHC, SDHD, of the succinate dehydrogenase complex in KIT/PDGFRA wild-type GIST. Eur J Hum Genet 2014-01-01 [PMID: 23612575] (IF/IHC) IF/IHC
Rapizzi E, Ercolino T, Canu L et al. Mitochondrial function and content in pheochromocytoma/paraganglioma of succinate dehydrogenase mutation carriers. Endocr Relat Cancer 2012-05-01 [PMID: 22323561]
Xekouki P, Pacak K, Almeida M et al. Succinate Dehydrogenase (SDH) D Subunit (SDHD) Inactivation in a Growth-Hormone-Producing Pituitary Tumor: A New Association for SDH?. J Clin Endocrinol Metab 2012-03-01 [PMID: 22170724]
Show All 16 Publications.

Reviews for SDHB Antibody (NBP1-87069) (0)

There are no reviews for SDHB Antibody (NBP1-87069). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SDHB Antibody (NBP1-87069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SDHB Products

Bioinformatics Tool for SDHB Antibody (NBP1-87069)

Discover related pathways, diseases and genes to SDHB Antibody (NBP1-87069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDHB Antibody (NBP1-87069)

Discover more about diseases related to SDHB Antibody (NBP1-87069).
 

Pathways for SDHB Antibody (NBP1-87069)

View related products by pathway.

PTMs for SDHB Antibody (NBP1-87069)

Learn more about PTMs related to SDHB Antibody (NBP1-87069).
 

Research Areas for SDHB Antibody (NBP1-87069)

Find related products by research area.

Blogs on SDHB.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDHB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHB