Home » Integrin alpha 8 » Integrin alpha 8 Antibodies » Integrin alpha 8 Antibody (CL7304)

Integrin alpha 8 Antibody (CL7304)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Analysis in human cell line HEK 293.
Western Blot: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Staining of human prostate shows moderate to strong positivity in smooth muscle cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Analysis in human lung and pancreas tissues. Corresponding ITGA8 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Staining of human lung shows strong membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL7304
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Integrin alpha 8 Antibody (CL7304) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Epitope
HKEEEVGPLVEHIYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Integrin alpha 8 Antibody (CL7304)

  • Integrin alpha 8
  • integrin alpha-8
  • integrin, alpha 8
  • ITGA8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP-9 [HRP]
DMP900
(7 Reviews)
(164 Publications)
Species: Hu
MMP-2 [HRP]
MMP200
(1 Review)
(61 Publications)
Species: Hu, Mu, Rt, Po, Ca
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Western Blot: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Analysis of Integrin beta 3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: HUVEC cell lysateLane 2: mouse marrow tissue lysate
Immunocytochemistry/Immunofluorescence: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Staining Integrin beta 3 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Mouse lung tissue. IF-stained paraffin section. Image from verified customer review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Slug Antibody
(OTI1A6)
NBP2-03886
Western Blot: SLUG Antibody (1A6) [NBP2-03886] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLUG (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SLUG.
Immunohistochemistry-Paraffin: Slug Antibody (1A6) [NBP2-03886] - Mouse glioma stained with Slug antibody. Image from verified customer review.
Flow Cytometry: SLUG Antibody (1A6) [NBP2-03886] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SLUG antibody, and then analyzed by flow cytometry.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
ZEB2 Antibody
NBP1-82991
Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (https://jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
(2 Reviews)
(19 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
FGFR1 Antibody
(M19B2)
NB600-1287
Western Blot: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis of MCF7 (A), HepG2 (B), NIH3T3 (C), and PC-12 (D) cell lysate using FGF R1 antibody at 2 ug/ml.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis using the Alexa Fluor 488 (R) conjugate of NB600-1287. Staining of FGF R1 in HEK293 and HEK293 FGFR transfected cells using anti-FGF R1 antibody. (Red) Positive cells, (Green) Negative cells, (Blue) Negative cells + antibody, (Pink) Positive cells + antibody. Image from verified customer review.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using FGF R1 antibody (Dark Blue) and Isotype control (Orange). An antibody concentration of 1 ug/1x10^6 cells was used.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
ZEB1 Antibody
NBP1-05987
Immunohistochemistry: ZEB1 Antibody [NBP1-05987] - Immunohistochemical staining results of EMT regulators in HG-PanIN: SNAIL, SLUG, TWIST1, and ZEB1. We categorized and defined three grades: grade 0, <10% positive staining; grade 1, 10%-50% positive; grade 2, 50%< positive Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1002/cam4.2016) licensed under a CC-BY licence.
Western Blot: ZEB1 Antibody [NBP1-05987] - Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ZEB1 antibody (NBP1-05987) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-05987] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-ZEB1 (NBP1-05987) used at a dilution of 1:1000 (0.2 ug/ml). Detection: DAB.
(6 Reviews)
(62 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
KLF8 Antibody
NBP2-27418
Western Blot: KLF8 Antibody [NBP2-27418] - Analysis of KLF8 using KLF8 antibody. Human Kidney tissue lysate in the 1) absence and 2) presence of immunizing peptide and 3) HEK293 lysate probed with 2 ug/ml of KLF8 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Pm
Applications: WB
Integrin beta 5
Antibody
AF8035
Western blot shows lysates of CMT-93 mouse rectal carcinoma cell line and C6 rat glioma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse Integrin  beta 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8035) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Integrin  beta 5 at approximately 95 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
bEnd.3 mouse endothelioma cell line was stained with Sheep Anti-Mouse/Rat Integrin  beta 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8035, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by Allophycocyanin-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0127).
Integrin  beta 5 was detected in perfusion fixed frozen sections of mouse brain using Sheep Anti-Mouse/Rat Integrin  beta 5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8035) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Northern­Lights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010). Specific staining was localized to glial cells. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Integrin alpha
4/CD49d Antibody (PS/
NBP1-26661
Immunohistochemistry-Paraffin: Integrin alpha 4/CD49d Antibody (PS/2) [NBP1-26661] - FFPE human ovarian carcinoma. Antibody at 1:10. HIER antigen retrieval at pH 6. HRP/DAB detetion. IHC-P image submitted by a verified customer review.
Flow Cytometry: Integrin alpha 4/CD49d Antibody (PS/2) [NBP1-26661] - BALB/c mouse splenocytes were stained with Rat Anti-Mouse CD49d-UNLB followed by Mouse Anti-Rat IgG2b-AF647.
Flow Cytometry: Integrin alpha 4/CD49d Antibody (PS/2) [NBP1-26661] - Less or equal to 2 ug/10^6 cellsCells from BALB/c bone marrow were stained with rat anti-mouse CD49d: FITC, following which lymphocytes were gated and analyzed on a flow cytometer.
(1 Review)
Species: Hu, Mu
Applications: Flow, IHC, IHC-P
PDGF R beta
Antibody [Unconjugate
AF1042
PDGF R beta was detected in immersion fixed frozen sections of mouse embryo spinal cord using 5 µg/mL Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of rat spinal cord tissue, rat brain tissue, and mouse brain tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDGF R beta at approximately 190 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(28 Publications)
Species: Mu
Applications: WB, IHC
PDGFR alpha
Antibody [Unconjugate
AF1062
Western blot shows lysates of mouse uterus tissue and mouse lung tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse PDGF R alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1062) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for PDGF R alpha at approximately 160-200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PDGF R alpha was detected in immersion fixed frozen sections of mouse embryo using 15 µg/mL Goat Anti-Mouse PDGF R alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1062) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the plasma membrane of mesenchymal cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Recombinant Human PDGF‑AA (Catalog # 221-AA) stimulates proliferation in the NR6R‑3T3 mouse fibroblast cell line in a dose-dependent manner (orange line), as measured by Resazurin (Catalog # AR002. Proliferation elicited by Recombinant Human PDGF‑AA (250 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Mouse PDGF R alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1062). The ND50 is typically 0.2-1.6 µg/mL.
(13 Reviews)
(60 Publications)
Species: Mu
Applications: WB, IHC, Neut
FAK Antibody
(SR46-04)
NBP2-67327
Western Blot: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of FAK on different lysates using anti-FAK antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Mouse spleen
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in PANC-1 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded huamn liver cancer tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NCAM-1/CD56
Antibody (123C3.D5)
NBP2-15184
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)
Flow (Cell Surface): NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - A surface stain was performed on U-87 Cells with NCAM-1/CD56 Antibody (123C3) NBP2-33132B and a matched isotype control. Both antibodies were conjugated to biotin. Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Flow Cytometry: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.
(1 Review)
(5 Publications)
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - VSOP observed in perivascular-restricted spinal cord lesions with intact BBB. Immunostaining for laminin (brown) shows vascular endothelium and glia limitans of a perivascular lesion, along with infiltrating cells and VSOP (blue). Image collected and cropped by CiteAb from the following publication (http://asn.sagepub.com/lookup/doi/10.1042/AN20120081), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(11 Reviews)
(30 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Osteopontin/OPN
Antibody [Unconjugate
AF808
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(7 Reviews)
(81 Publications)
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
N-Cadherin
Antibody (13A9)
NBP1-48309
Immunocytochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - Immunostaining of original tumor, low passage, and high passage KCI-MENG1 cells. The original patient-derived tumor (top row) showed moderate and patchy immunoreactivity for epithelial membrane antigen (EMA); strong and diffuse immunostaining for progesterone receptor (PR); and a Ki-67 proliferative index of 2-3%. There was also strong immunostaining for N-cadherin and vimentin. KCI-MENG1-LP cells (middle row) and KCI-MENG1-HP cells (bottom row) maintained expression of EMA, N-cadherin, and vimentin but had significantly reduced PR expression compared to the original tumor. Whereas Ki-67 labeling was found in only a small number of cells in the original tumor and low passage cells, it was positive in virtually all P84 cells. Scale bar 50 um. Image collected and cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/227), licensed under a CC-BY licence.
Western Blot: N-Cadherin Antibody (13A9) [NBP1-48309] - Analysis of N-Cadherin expression in HeLa whole cell lysate.
Immunocytochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - Human meningioma mouse xenograft model KCI-MENG1-LPSX generated with the spontaneously immortal cell line KCI-MENG1-LP. Tumors from immunocompromised SCID mice were dissected and the derivative cell line KCI-MENG1-LPSX CL was generated. The EMA, PR, and N-cadherin IHC of the mouse tumor highly resembled the original patient-derived tumor. The vimentin- and Ki-67-stained cells in the mouse tumor tissue were markedly more abundant and more intensely stained than in the original tumor. KCI-MENG1-LPSX CL cells displayed the same patterns of immunostaining as the high passage parent cell line KCI-MENG1-HP, including the loss of PR staining. Scale bar 50 um. Image collected and cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/227), licensed under a CC-BY licence.
(1 Review)
(33 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
Mer Antibody
[Unconjugated]
AF591
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Mer was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sperm cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Mer mRNA was detected in formalin-fixed paraffin-embedded tissue sections of mouse kidney probed with ACD RNAScope® Probe (Catalog # 441241) and stained using ACD RNAscope® 2.5 HD Detection Reagents-Red (top image, Catalog # 32260). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591) at 1 ug/mL with overnight incubation at 4 °C followed by incubation with the Anti-Goat IgG VisUCyte HRP Polymer Antibody (R&D Systems,  Catalog # VC004) and DAB chromogen (lower image, yellow-brown). Tissues were counterstained with hematoxylin (blue).
(3 Reviews)
(30 Publications)
Species: Mu
Applications: Flow, IHC, CyTOF-ready, Dual ISH-IHC
TGF-beta RII
Antibody [Unconjugate
AF-241-NA
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Hep3B human hepatocellular carcinoma cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, HT1080 human fibrosarcoma cell line, and DU145 human prostate carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Goat Anti-Human TGF‑ beta  RII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-241-NA) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for TGF‑ beta  RII at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human TGF‑ beta 1 (Catalog # 240-B) inhibits Recombinant Human IL‑4 (Catalog # 204-IL) induced proliferation in the TF‑1 human erythroleukemic cell line in a dose-dependent manner (orange line). Inhibition of Recombinant Human IL‑4 (5 ng/mL) activity elicited by Recombinant Human TGF‑ beta 1 (0.04 ng/mL) is neutral­ized (green line) by increasing concentrations of Goat Anti- Human TGF‑ beta  RII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-241-NA). The ND50 is typically10‑20 µg/mL.
TGF-beta  RII was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human TGF-beta  RII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-241-NA) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(17 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
SLC22A3 Antibody
NBP1-69368
Western Blot: SLC22A3 Antibody [NBP1-69368] - This Anti-SLC22A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC22A3 Antibody [NBP1-69368] - Human kidney
Species: Hu
Applications: WB, IHC, IHC-P
GEM Antibody
NBP1-58906
Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.
Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.
Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Integrin alpha 8
Antibody (CL7304)
NBP2-76482
Integrin alpha 8 Antibody (CL7304)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 8 Antibody (NBP2-76482) (0)

There are no publications for Integrin alpha 8 Antibody (NBP2-76482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 8 Antibody (NBP2-76482) (0)

There are no reviews for Integrin alpha 8 Antibody (NBP2-76482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 8 Antibody (NBP2-76482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Integrin alpha 8 Products

Bioinformatics Tool for Integrin alpha 8 Antibody (NBP2-76482)

Discover related pathways, diseases and genes to Integrin alpha 8 Antibody (NBP2-76482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 8 Antibody (NBP2-76482)

Discover more about diseases related to Integrin alpha 8 Antibody (NBP2-76482).
 

Pathways for Integrin alpha 8 Antibody (NBP2-76482)

View related products by pathway.

PTMs for Integrin alpha 8 Antibody (NBP2-76482)

Learn more about PTMs related to Integrin alpha 8 Antibody (NBP2-76482).

Blogs on Integrin alpha 8

There are no specific blogs for Integrin alpha 8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 8 Antibody (CL7304) and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGA8