Integrin alpha 8 Antibody (CL7304)

Images

 
Western Blot: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Staining of human prostate shows moderate to strong positivity in smooth muscle cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Analysis in human lung and pancreas tissues. Corresponding ITGA8 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Staining of human lung shows strong membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody (CL7304) [NBP2-76482] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL7304
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Integrin alpha 8 Antibody (CL7304) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Epitope
HKEEEVGPLVEHIYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Integrin alpha 8 Antibody (CL7304)

  • Integrin alpha 8
  • integrin alpha-8
  • integrin, alpha 8
  • ITGA8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
NBP2-27418
Species: Hu, Pm
Applications: WB
AF8035
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-26661
Species: Hu, Mu
Applications: Flow, IHC, IHC-P
AF1042
Species: Mu
Applications: WB, IHC
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready, Dual ISH-IHC
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-76482
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 8 Antibody (NBP2-76482) (0)

There are no publications for Integrin alpha 8 Antibody (NBP2-76482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 8 Antibody (NBP2-76482) (0)

There are no reviews for Integrin alpha 8 Antibody (NBP2-76482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 8 Antibody (NBP2-76482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Integrin alpha 8 Products

Bioinformatics Tool for Integrin alpha 8 Antibody (NBP2-76482)

Discover related pathways, diseases and genes to Integrin alpha 8 Antibody (NBP2-76482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 8 Antibody (NBP2-76482)

Discover more about diseases related to Integrin alpha 8 Antibody (NBP2-76482).
 

Pathways for Integrin alpha 8 Antibody (NBP2-76482)

View related products by pathway.

PTMs for Integrin alpha 8 Antibody (NBP2-76482)

Learn more about PTMs related to Integrin alpha 8 Antibody (NBP2-76482).

Blogs on Integrin alpha 8

There are no specific blogs for Integrin alpha 8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 8 Antibody (CL7304) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA8