| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit IL-10 Antibody - BSA Free (NBP3-21346) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IL10 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IL-10 Antibody (NBP3-21346)Find related products by research area.
|
|
Read full blog post. |
|
Success of combined IL-10 and IL-12 therapy in colon cancer depends on IFN-gamma and gut barrier integrity By Jamshed Arslan, Pharm. D., PhD. Colon cancer is responsible for over 600,000 deaths per year worldwide. Colon cancer can be classified into two categories: mismatch repair (MMR)-deficient and MMR-proficient cancers... Read full blog post. |
|
How To Identify B Cell Subsets Using Flow Cytometry By Victoria OsinskiUsing Flow Cytometry to Identify B Cell SubsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified... Read full blog post. |
|
PPAR gamma - An important target in human metabolism Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells by interacting with members of the nuclear hormone receptor superfamily known as peroxisome proliferator activated receptors (PPARs). There are f... Read full blog post. |
|
CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IL10 |