Huntingtin Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 435-635 of human Huntingtin (NP_002102.4). PVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNM |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HTT |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Huntingtin Antibody - Azide and BSA Free
Background
Huntingtin protein (Htt) is a 348 kDa protein product of Huntington's disease (HD, IT15) gene. Huntington's disease is a neurodegenerative disorder caused by a mutation on the HD gene, producing a polyglutamin (polyQ) expansion on the N-terminus of Htt. The mutant Htt leads to cytotoxicity in the striatal neuron (1). This cytotoxicity is modulated by proteolytic cleavage with caspases and calpains, producing N-terminal polyQ fragments. A phosphorylation of Htt may also regulate the cleavage and cytotoxicity of mutant Htt (2). The wild-type Htt up-regulates transcription of brain-derived neurotrophic factor (BDNF), a pro-survival factor for striatal neurons. This suggests restoring wild-type Htt level and increasing BDNF expression level can be therapeutic treatment for Huntington's disease (3). Huntingtin is also cleaved by apopain, a cysteine protease product of death-gene for human, suggesting HD might be a disorder of inappropriate apoptosis (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Huntingtin Antibody (NBP3-15492) (0)
There are no publications for Huntingtin Antibody (NBP3-15492).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Huntingtin Antibody (NBP3-15492) (0)
There are no reviews for Huntingtin Antibody (NBP3-15492).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Huntingtin Antibody (NBP3-15492) (0)