HO-1/HMOX1/HSP32 Antibody

Images

 
Western Blot: HO-1/HMOX1/HSP32 Antibody [NBP1-89964] - Analysis in human cell lines A-549 and MCF-7 using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody [NBP1-89964] - Staining of human bone marrow shows strong positivity in macrophages.
Western Blot: HO-1/HMOX1/HSP32 Antibody [NBP1-89964] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

HO-1/HMOX1/HSP32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
Marker
Oxidative Stress Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMOX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HO-1/HMOX1/HSP32 Protein (NBP1-89964PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HO-1/HMOX1/HSP32 Antibody

  • bK286B10
  • EC 1.14.99.3
  • heat shock protein, 32-kD
  • heme oxygenase (decycling) 1
  • HMOX1
  • HO
  • HO1
  • HO-1
  • HO-1heme oxygenase 1
  • HSP32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89964
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HO-1/HMOX1/HSP32 Antibody (NBP1-89964) (0)

There are no publications for HO-1/HMOX1/HSP32 Antibody (NBP1-89964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HO-1/HMOX1/HSP32 Antibody (NBP1-89964) (0)

There are no reviews for HO-1/HMOX1/HSP32 Antibody (NBP1-89964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HO-1/HMOX1/HSP32 Antibody (NBP1-89964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HO-1/HMOX1/HSP32 Products

Bioinformatics Tool for HO-1/HMOX1/HSP32 Antibody (NBP1-89964)

Discover related pathways, diseases and genes to HO-1/HMOX1/HSP32 Antibody (NBP1-89964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HO-1/HMOX1/HSP32 Antibody (NBP1-89964)

Discover more about diseases related to HO-1/HMOX1/HSP32 Antibody (NBP1-89964).
 

Pathways for HO-1/HMOX1/HSP32 Antibody (NBP1-89964)

View related products by pathway.

PTMs for HO-1/HMOX1/HSP32 Antibody (NBP1-89964)

Learn more about PTMs related to HO-1/HMOX1/HSP32 Antibody (NBP1-89964).
 

Research Areas for HO-1/HMOX1/HSP32 Antibody (NBP1-89964)

Find related products by research area.

Blogs on HO-1/HMOX1/HSP32

There are no specific blogs for HO-1/HMOX1/HSP32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HO-1/HMOX1/HSP32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMOX1
Entrez