Grancalcin Antibody

Images

 
Independent Antibodies: Western Blot: Grancalcin Antibody [NBP1-89785] - Analysis using Anti-GCA antibody NBP1-89785 (A) shows similar pattern to independent antibody NBP1-89786 (B).
Orthogonal Strategies: Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining in human bone marrow and cerebral cortex tissues using anti-GCA antibody. Corresponding GCA RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human bone marrow, cerebral cortex, kidney and liver using Anti-GCA antibody NBP1-89785 (A) shows similar ...read more
Immunocytochemistry/ Immunofluorescence: Grancalcin Antibody [NBP1-89785] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human liver.
Western Blot: Grancalcin Antibody [NBP1-89785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Grancalcin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Grancalcin Protein (NBP1-89785PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Grancalcin Antibody

  • EF-hand calcium-binding protein
  • grancalcin, EF-hand calcium binding protein
  • grancalcin, penta-EF-hand protein

Background

Grancalcin, is a calcium-binding protein abundant in neutrophils and macrophages. It belongs to the penta-EF-hand subfamily of proteins which includes sorcin, calpain, and ALG-2. Grancalcin localization is dependent upon calcium and magnesium. In the absence of divalent cation, grancalcin localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions, suggesting a role for grancalcin in granule-membrane fusion and degranulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-33405
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
DBD00
Species: Hu
Applications: ELISA
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB

Publications for Grancalcin Antibody (NBP1-89785) (0)

There are no publications for Grancalcin Antibody (NBP1-89785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Grancalcin Antibody (NBP1-89785) (0)

There are no reviews for Grancalcin Antibody (NBP1-89785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Grancalcin Antibody (NBP1-89785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Grancalcin Products

Diseases for Grancalcin Antibody (NBP1-89785)

Discover more about diseases related to Grancalcin Antibody (NBP1-89785).
 

Pathways for Grancalcin Antibody (NBP1-89785)

View related products by pathway.

PTMs for Grancalcin Antibody (NBP1-89785)

Learn more about PTMs related to Grancalcin Antibody (NBP1-89785).
 

Research Areas for Grancalcin Antibody (NBP1-89785)

Find related products by research area.

Blogs on Grancalcin

There are no specific blogs for Grancalcin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Grancalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCA