Grancalcin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Grancalcin Antibody [NBP1-89785] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human bone marrow, cerebral cortex, kidney and liver using Anti-GCA antibody NBP1-89785 (A) shows similar protein distribution across tissues to independent antibody NBP1-89786 (B).

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining in human bone marrow and cerebral cortex tissues using anti-GCA antibody. Corresponding GCA RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human liver.

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human kidney.

Analysis using Anti-GCA antibody NBP1-89785 (A) shows similar pattern to independent antibody NBP1-89786 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Grancalcin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Grancalcin Protein (NBP1-89785PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Grancalcin Antibody - BSA Free

• EF-hand calcium-binding protein
• grancalcin, EF-hand calcium binding protein
• grancalcin, penta-EF-hand protein

Background

Grancalcin, is a calcium-binding protein abundant in neutrophils and macrophages. It belongs to the penta-EF-hand subfamily of proteins which includes sorcin, calpain, and ALG-2. Grancalcin localization is dependent upon calcium and magnesium. In the absence of divalent cation, grancalcin localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions, suggesting a role for grancalcin in granule-membrane fusion and degranulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCA