Grancalcin Antibody

Images

 
Western Blot: Grancalcin Antibody [NBP1-89785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: Grancalcin Antibody [NBP1-89785] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
Western Blot: Grancalcin Antibody [NBP1-89785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Grancalcin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
Grancalcin Protein (NBP1-89785PEP)

Alternate Names for Grancalcin Antibody

  • EF-hand calcium-binding protein
  • grancalcin, EF-hand calcium binding protein
  • grancalcin, penta-EF-hand protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3925
Species: Hu, Mu, Rt
Applications: WB
NBP1-59088
Species: Hu
Applications: WB, ICC/IF
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-33405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-WhMt
NBP1-84942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt

Publications for Grancalcin Antibody (NBP1-89785) (0)

There are no publications for Grancalcin Antibody (NBP1-89785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Grancalcin Antibody (NBP1-89785) (0)

There are no reviews for Grancalcin Antibody (NBP1-89785). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Grancalcin Antibody (NBP1-89785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Grancalcin Antibody Products

Related Products by Gene

Bioinformatics Tool for Grancalcin Antibody (NBP1-89785)

Discover related pathways, diseases and genes to Grancalcin Antibody (NBP1-89785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Grancalcin Antibody (NBP1-89785)

Discover more about diseases related to Grancalcin Antibody (NBP1-89785).
 

Pathways for Grancalcin Antibody (NBP1-89785)

View related products by pathway.

PTMs for Grancalcin Antibody (NBP1-89785)

Learn more about PTMs related to Grancalcin Antibody (NBP1-89785).

Blogs on Grancalcin

There are no specific blogs for Grancalcin, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GCA

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89785 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought