Grancalcin Antibody

Images

 
Western Blot: Grancalcin Antibody [NBP1-89785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: Grancalcin Antibody [NBP1-89785] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89785] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
Western Blot: Grancalcin Antibody [NBP1-89785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Grancalcin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
Grancalcin Protein (NBP1-89785PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Grancalcin Antibody

  • EF-hand calcium-binding protein
  • grancalcin, EF-hand calcium binding protein
  • grancalcin, penta-EF-hand protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-59088
Species: Hu
Applications: WB, ICC/IF
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-33405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-WhMt
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IF, IHC-FrFl
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-858
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt

Publications for Grancalcin Antibody (NBP1-89785) (0)

There are no publications for Grancalcin Antibody (NBP1-89785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Grancalcin Antibody (NBP1-89785) (0)

There are no reviews for Grancalcin Antibody (NBP1-89785). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Grancalcin Antibody (NBP1-89785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Grancalcin Antibody Products

Related Products by Gene

Bioinformatics Tool for Grancalcin Antibody (NBP1-89785)

Discover related pathways, diseases and genes to Grancalcin Antibody (NBP1-89785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Grancalcin Antibody (NBP1-89785)

Discover more about diseases related to Grancalcin Antibody (NBP1-89785).
 

Pathways for Grancalcin Antibody (NBP1-89785)

View related products by pathway.

PTMs for Grancalcin Antibody (NBP1-89785)

Learn more about PTMs related to Grancalcin Antibody (NBP1-89785).

Blogs on Grancalcin

There are no specific blogs for Grancalcin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Grancalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCA

Customers Who Bought This Also Bought