GCLC Antibody (3H1)

Images

 
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1. Analysis of GCLC expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: GCLC Antibody (3H1) [H00002729-M01] - Analysis of monoclonal antibody to GCLC on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1. Analysis of GCLC expression in PC-12.
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1 Analysis of GCLC expression in A-431.
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - Analysis of GCLC expression in transfected 293T cell line by GCLC monoclonal antibody (M01), clone 3H1.Lane 1: GCLC transfected lysate(72.8 KDa).Lane 2: ...read more
Sandwich ELISA: GCLC Antibody (3H1) [H00002729-M01] - Detection limit for recombinant GST tagged GCLC is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GCLC Antibody (3H1) Summary

Immunogen
GCLC (NP_001489 528 a.a. - 637 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
Specificity
GCLC - glutamate-cysteine ligase, catalytic subunit
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GCLC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publications using
H00002729-M01 in the following applications:

  • WB
    3 publications

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCLC Antibody (3H1)

  • EC 6.3.2.2
  • gamma-ECS
  • Gamma-glutamylcysteine synthetase
  • GCS heavy chain
  • GCS
  • GLCL
  • GLCLCGCL
  • glutamate--cysteine ligase catalytic subunit
  • glutamate-cysteine ligase, catalytic subunit

Background

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773 kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-33405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB

Publications for GCLC Antibody (H00002729-M01)(9)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(2)
Mouse
(2)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00002729-M01 Applications Species
Sanchez-Martin FJ, Fan Y, Carreira V et al. Long-term Coexposure to Hexavalent Chromium and B[a]P Causes Tissue-Specific Differential Biological Effects in Liver and Gastrointestinal Tract of Mice Toxicol. Sci. 2015 Mar 29 [PMID: 25820237] (WB, Mouse) WB Mouse
Vene R, Cardinali B, Arena G et al. Glycogen Synthase Kinase 3 Regulates Cell Death and Survival Signaling in Tumor Cells under Redox Stress. Neoplasia. 2014 Jul 31 [PMID: 25246272]
Sugiyama K, Ebinuma H, Nakamoto N et al. Prominent steatosis with hypermetabolism of the cell line permissive for years of infection with hepatitis C virus. PLoS One. 2014 Apr 09 [PMID: 24718268]
Fan X, Liu X, Hao S et al. The LEGSKO Mouse: A Mouse Model of Age-Related Nuclear Cataract Based on Genetic Suppression of Lens Glutathione Synthesis. PLoS One. 2012 Nov 30 [PMID: 23226398]
Li M, Gunter ME, Fukagawa NK. Differential activation of the inflammasome in THP-1 cells exposed to chrysotile asbestos and Libby 'six-mix' amphiboles and subsequent activation of BEAS-2B cells. Cytokine. 2012 Sep 24 [PMID: 23017228]
Kang H, Hong YB, Kim HJ et al. Bioactive food components prevent carcinogenic stress via Nrf2 activation in BRCA1 deficient breast epithelial cells Toxicology Letters 2012 Mar 12 [PMID: 22192953] (WB, Human) WB Human
Abel EL, Bubel JD, Simper MS et al. Protection against 2-chloroethyl ethyl sulfide (CEES) - Induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway. Toxicol Appl Pharmacol. 2011 Jun 23 [PMID: 21723306]
Hardwick RN, Fisher CD, Canet MJ et al. Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease. Drug Metab Dispos 38(12):2293-301. 2010 Dec. [PMID: 20805291]
Yang H, Ko K, Xia M et al. Induction of avian musculoaponeurotic fibrosarcoma proteins by toxic bile acid inhibits expression of glutathione synthetic enzymes and contributes to cholestatic liver injury in mice. Hepatology 2010 Apr [PMID: 20146260] (WB, Human, Mouse) WB Human, Mouse

Reviews for GCLC Antibody (H00002729-M01) (0)

There are no reviews for GCLC Antibody (H00002729-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCLC Antibody (H00002729-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCLC Products

Bioinformatics Tool for GCLC Antibody (H00002729-M01)

Discover related pathways, diseases and genes to GCLC Antibody (H00002729-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCLC Antibody (H00002729-M01)

Discover more about diseases related to GCLC Antibody (H00002729-M01).
 

Pathways for GCLC Antibody (H00002729-M01)

View related products by pathway.

PTMs for GCLC Antibody (H00002729-M01)

Learn more about PTMs related to GCLC Antibody (H00002729-M01).
 

Research Areas for GCLC Antibody (H00002729-M01)

Find related products by research area.

Blogs on GCLC.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCLC Antibody (3H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol GCLC
Entrez
OMIM
Uniprot