Glutaminase Antibody

Images

 
Western Blot: Glutaminase Antibody [NBP1-89766] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Immunofluorescent staining of human cell line SiHa shows localization to mitochondria.
Immunohistochemistry: Glutaminase Antibody [NBP1-89766] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutaminase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutaminase Protein (NBP1-89766PEP)
Publications
Read Publication using
NBP1-89766 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25798620).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutaminase Antibody

  • AAD20
  • EC 3.5.1.2
  • GLS1DKFZp686O15119
  • glutaminase C
  • glutaminase kidney isoform, mitochondrial
  • glutaminase
  • glutaminase, phosphate-activated
  • K-glutaminase
  • KIAA0838FLJ10358
  • L-glutamine amidohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008833-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glutaminase Antibody (NBP1-89766)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Glutaminase Antibody (NBP1-89766) (0)

There are no reviews for Glutaminase Antibody (NBP1-89766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutaminase Antibody (NBP1-89766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutaminase Products

Bioinformatics Tool for Glutaminase Antibody (NBP1-89766)

Discover related pathways, diseases and genes to Glutaminase Antibody (NBP1-89766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutaminase Antibody (NBP1-89766)

Discover more about diseases related to Glutaminase Antibody (NBP1-89766).
 

Pathways for Glutaminase Antibody (NBP1-89766)

View related products by pathway.

PTMs for Glutaminase Antibody (NBP1-89766)

Learn more about PTMs related to Glutaminase Antibody (NBP1-89766).

Blogs on Glutaminase

There are no specific blogs for Glutaminase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutaminase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS