Glutaminase Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining in human kidney and skeletal muscle tissues using NBP1-89766 antibody. Corresponding GLS RNA-seq data are ...read more
Western Blot: Glutaminase Antibody [NBP1-89766] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining of human cell line SiHa shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Glutaminase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutaminase Protein (NBP1-89766PEP)
Publications
Read Publications using
NBP1-89766 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25798620). Rat reactivity reported in scientific literature (PMID: 31265816).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutaminase Antibody

  • AAD20
  • EC 3.5.1.2
  • GLS
  • GLS1DKFZp686O15119
  • glutaminase C
  • glutaminase kidney isoform, mitochondrial
  • Glutaminase
  • glutaminase, phosphate-activated
  • K-Glutaminase
  • KIAA0838FLJ10358
  • L-Glutamine Amidohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008833-M01
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00030851-M01
Species: Hu
Applications: ELISA, S-ELISA, Simple Western, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glutaminase Antibody (NBP1-89766)(2)

We have publications tested in 2 confirmed species: Mouse, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
Rat
(1)
All Species

Reviews for Glutaminase Antibody (NBP1-89766) (0)

There are no reviews for Glutaminase Antibody (NBP1-89766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutaminase Antibody (NBP1-89766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutaminase Products

Bioinformatics Tool for Glutaminase Antibody (NBP1-89766)

Discover related pathways, diseases and genes to Glutaminase Antibody (NBP1-89766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutaminase Antibody (NBP1-89766)

Discover more about diseases related to Glutaminase Antibody (NBP1-89766).
 

Pathways for Glutaminase Antibody (NBP1-89766)

View related products by pathway.

PTMs for Glutaminase Antibody (NBP1-89766)

Learn more about PTMs related to Glutaminase Antibody (NBP1-89766).
 

Research Areas for Glutaminase Antibody (NBP1-89766)

Find related products by research area.

Blogs on Glutaminase

There are no specific blogs for Glutaminase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutaminase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS