GGT1 Antibody (1F9)

Images

 
Western Blot: GGT1 Antibody (1F9) [H00002678-M01] - GGT1 monoclonal antibody (M01), clone 1F9 Analysis of GGT1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Immunoprecipitation: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: GGT1 Antibody (1F9) [H00002678-M01] - Detection limit for recombinant GST tagged GGT1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, YeSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clone
1F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GGT1 Antibody (1F9) Summary

Immunogen
GGT1 (NP_005256, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
Specificity
GGT1 - gamma-glutamyltransferase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GGT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 29935878).
Publications
Read Publications using
H00002678-M01 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GGT1 Antibody (1F9)

  • CD224 antigen
  • CD224
  • D22S672
  • D22S732
  • EC 2.3.2.2
  • gamma-glutamyl transpeptidase
  • gamma-glutamyltransferase 1MGC96904
  • gamma-glutamyltranspeptidase 1
  • GGT 1
  • GGTMGC96963
  • glutamyl transpeptidase
  • GTG
  • MGC96892

Background

Human gamma-glutamyltransferase catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. This heteroduplex enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein, and is present in tissues involved in absorption and secretion. This enzyme is a member of the gamma-glutamyltransferase protein family, of which many members have not yet been fully characterized. This gene encodes several transcript variants; studies suggest that many transcripts of this gene family may be non-functional or represent pseudogenes. The functional transcripts which have been fully characterized have been grouped and classified as type I gamma-glutamyltransferase. Complex splicing events may take place in a tissue-specific manner, resulting in marked dissimilarity in the 5' UTRs. Several 5' UTR transcript variants of the type I gene have been identified in different tissues and cancer cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO

Publications for GGT1 Antibody (H00002678-M01)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 7 of 7.
Publications using H00002678-M01 Applications Species
Kubo H, Hanaoka K, Kuriki Y et al. Rapid detection of metastatic lymph nodes of colorectal cancer with a gamma-glutamyl transpeptidase-activatable fluorescence probe. Sci Rep Dec 12 2018 [PMID: 30542087]
Grammatikopoulos T, Deheragoda M, Strautnieks S et al. Reduced Hepatocellular Expression of Canalicular Transport Proteins in Infants with Neonatal Cholestasis and Congenital Hypopituitarism J. Pediatr. Jun 20 2018 [PMID: 29935878] (IHC, Human) IHC Human
Kawakami K, Fujita Y, Matsuda Y et al. Gamma-glutamyltransferase activity in exosomes as a potential marker for prostate cancer. BMC Cancer 2017 May 5 [PMID: 28476099]
Blackmore L, Knisely AS, Hartley JL et al. Polymorphisms in ABCB11 and ATP8B1 Associated with Development of Severe Intrahepatic Cholestasis in Hodgkin's Lymphoma. Journal of Clinical and Experimental Hepatology. 2012 [PMID: 25755490]
Grau L, Luque-Garcia JL, Gonzalez-Peramato P et al. A quantitative proteomic analysis uncovers the relevance of CUL3 in bladder cancer aggressiveness. PLoS One. 2013 [PMID: 23308193] (Human) Human
West MB, Wickham S, Quinalty LM et al. Autocatalytic cleavage of human {gamma}-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95. J Biol Chem. 2011 Jun 28 [PMID: 21712391]
West MB, Segu ZM, Feasley CL et al. Analysis of site-specific glycosylation of renal and hepatic gamma-glutamyl transpeptidase from normal human tissue. J Biol Chem. 2010 Jul 09 [PMID: 20622017]

Reviews for GGT1 Antibody (H00002678-M01) (0)

There are no reviews for GGT1 Antibody (H00002678-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GGT1 Antibody (H00002678-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GGT1 Products

Bioinformatics Tool for GGT1 Antibody (H00002678-M01)

Discover related pathways, diseases and genes to GGT1 Antibody (H00002678-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGT1 Antibody (H00002678-M01)

Discover more about diseases related to GGT1 Antibody (H00002678-M01).
 

Pathways for GGT1 Antibody (H00002678-M01)

View related products by pathway.

PTMs for GGT1 Antibody (H00002678-M01)

Learn more about PTMs related to GGT1 Antibody (H00002678-M01).
 

Research Areas for GGT1 Antibody (H00002678-M01)

Find related products by research area.

Blogs on GGT1

There are no specific blogs for GGT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGT1 Antibody (1F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol GGT1
Entrez
OMIM
Uniprot